Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: CHIT1Sample Tissue: Human 786-0 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human CHIT1 Polyclonal Antibody | anti-CHIT1 antibody

CHIT1 Antibody - middle region

Gene Names
CHIT1; CHI3; CHIT; CHITD
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
CHIT1; Polyclonal Antibody; CHIT1 Antibody - middle region; anti-CHIT1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: WEYPGSQGSPAVDKERFTTLVQDLANAFQQEAQTSGKERLLLSAAVPAGQ
Sequence Length
466
Applicable Applications for anti-CHIT1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human CHIT1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: CHIT1Sample Tissue: Human 786-0 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: CHIT1Sample Tissue: Human 786-0 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-CHIT1 antibody
Chitotriosidase is secreted by activated human macrophages and is markedly elevated in plasma of Gaucher disease patients. The expression of chitotriosidase occurs only at a late stage of differentiation of monocytes to activated macrophages in culture. Human macrophages can synthesize a functional chitotriosidase, a highly conserved enzyme with a strongly regulated expression. This enzyme may play a role in the degradation of chitin-containing pathogens. Several alternatively spliced transcript variants have been described for this gene.
Product Categories/Family for anti-CHIT1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
51 kDa
NCBI Official Full Name
chitotriosidase-1 isoform 2
NCBI Official Synonym Full Names
chitinase 1
NCBI Official Symbol
CHIT1
NCBI Official Synonym Symbols
CHI3; CHIT; CHITD
NCBI Protein Information
chitotriosidase-1
UniProt Protein Name
Chitotriosidase-1
Protein Family
UniProt Gene Name
CHIT1
UniProt Entry Name
CHIT1_HUMAN

NCBI Description

Chitotriosidase is secreted by activated human macrophages and is markedly elevated in plasma of Gaucher disease patients. The expression of chitotriosidase occurs only at a late stage of differentiation of monocytes to activated macrophages in culture. Human macrophages can synthesize a functional chitotriosidase, a highly conserved enzyme with a strongly regulated expression. This enzyme may play a role in the degradation of chitin-containing pathogens. Several alternatively spliced transcript variants have been described for this gene. [provided by RefSeq, Jan 2012]

Uniprot Description

CHIT1: Degrades chitin, chitotriose and chitobiose. May participate in the defense against nematodes and other pathogens. Isoform 3 has no enzymatic activity. Belongs to the glycosyl hydrolase 18 family. Chitinase class II subfamily. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted; Hydrolase; Carbohydrate Metabolism - amino sugar and nucleotide sugar; EC 3.2.1.14; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 1q32.1

Cellular Component: extracellular space; lysosome

Molecular Function: endochitinase activity; chitin binding; chitinase activity

Biological Process: polysaccharide catabolic process; response to bacterium; immune response; chitin catabolic process

Disease: Chitotriosidase Deficiency

Research Articles on CHIT1

Similar Products

Product Notes

The CHIT1 chit1 (Catalog #AAA3224243) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CHIT1 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CHIT1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CHIT1 chit1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: WEYPGSQGSP AVDKERFTTL VQDLANAFQQ EAQTSGKERL LLSAAVPAGQ. It is sometimes possible for the material contained within the vial of "CHIT1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.