Rabbit anti-Mouse DLD Polyclonal Antibody | anti-DLD antibody

DLD Antibody - middle region

Cat. Num. AAA3223595

• Reactivity: Mouse
• Applications: Western Blot
• Purity: Affinity purified
• Synonyms: DLD; Polyclonal Antibody; DLD Antibody - middle region; anti-DLD antibody

• Host: Rabbit
• Reactivity: Mouse
• Clonality: Polyclonal
• Purity/Purification: Affinity purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: VAWVGKSEEQLKEEGIEFKIGKFPFAANSRAKTNADTDGMVKILGHKSTD
• Sequence Length: 509

• Applicable Applications for anti-DLD antibody: Western Blot (WB)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of mouse DLD
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: DLDSample Tissue: Mouse Lung lysatesAntibody Dilution: 1ug/ml)

Related Product Information for anti-DLD antibody

This gene encodes a member of the class-I pyridine nucleotide-disulfide oxidoreductase family. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. In homodimeric form, the encoded protein functions as a dehydrogenase and is found in several multi-enzyme complexes that regulate energy metabolism. However, as a monomer, this protein can function as a protease.

Product Categories/Family for anti-DLD antibody

Polyclonal; Cell Biology

NCBI and Uniprot Product Information

• NCBI GI #: 31982856
• NCBI GeneID: 13382
• NCBI Accession #: NP_031887.2
• NCBI GenBank Nucleotide #: NM_007861.5
• UniProt Accession #: O08749
• Molecular Weight: 55 kDa
• NCBI Official Full Name: dihydrolipoyl dehydrogenase, mitochondrial
• NCBI Official Synonym Full Names: dihydrolipoamide dehydrogenase
• NCBI Official Symbol: Dld
• NCBI Protein Information: dihydrolipoyl dehydrogenase, mitochondrial
• UniProt Protein Name: Dihydrolipoyl dehydrogenase, mitochondrial
• Protein Family: Delta-like protein
• UniProt Gene Name: Dld

NCBI Description

This gene encodes a member of the class-I pyridine nucleotide-disulfide oxidoreductase family. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. In homodimeric form, the encoded protein functions as a dehydrogenase and is found in several multi-enzyme complexes that regulate energy metabolism. However, as a monomer, this protein can function as a protease. [provided by RefSeq, Jan 2014]

Uniprot Description

Lipoamide dehydrogenase is a component of the glycine cleavage system as well as an E3 component of the alpha-ketoacid dehydrogenase complexes (pyruvate-, alpha-ketoglutarate-, and branched-chain amino acid-dehydrogenase complex). In monomeric form has additional moonlighting function as serine protease (PubMed:17404228). Involved in the hyperactivation of spermatazoa during capacitation and in the spermatazoal acrosome reaction ().