Western Blot (WB)
(WB Suggested Anti-SALF Antibody Titration: 5.0ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysate)
Rabbit SALF Polyclonal Antibody | anti-STON1-GTF2A1L antibody
SALF antibody - C-terminal region
Gene Names
STON1-GTF2A1L; ALF; SALF; GTF2A1L; GTF2A1LF
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Protein A purified
Synonyms
SALF; Polyclonal Antibody; SALF antibody - C-terminal region; anti-STON1-GTF2A1L antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NSGDDVSEQDVPDLFDTDNVIVCQYDKIHRSKNKWKFYLKDGVMCFGGRD
Sequence Length
1182
Applicable Applications for anti-STON1-GTF2A1L antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human SALF
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-SALF Antibody Titration: 5.0ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysate)
Western Blot (WB)
(WB Suggested Anti-SALF Antibody Titration: 5.0ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysate)
Related Product Information for anti-STON1-GTF2A1L antibody
This is a rabbit polyclonal antibody against SALF. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: The SALF mRNA is an infrequent but naturally occurring co-transcribed product of the neighboring SBLF and ALF genes. This rare transcript encodes a fusion protein composed of greater than 95% each of the individual elements, stoned B-like factor (SBLF) and TFIIA-alpha/beta-like factor (ALF). The significance of this co-transcribed mRNA and the function of its protein product have not yet been determined.
Target Description: The SALF mRNA is an infrequent but naturally occurring co-transcribed product of the neighboring SBLF and ALF genes. This rare transcript encodes a fusion protein composed of greater than 95% each of the individual elements, stoned B-like factor (SBLF) and TFIIA-alpha/beta-like factor (ALF). The significance of this co-transcribed mRNA and the function of its protein product have not yet been determined.
Product Categories/Family for anti-STON1-GTF2A1L antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
132kDa
NCBI Official Full Name
STON1-GTF2A1L protein isoform 1
NCBI Official Synonym Full Names
STON1-GTF2A1L readthrough
NCBI Official Symbol
STON1-GTF2A1L
NCBI Official Synonym Symbols
ALF; SALF; GTF2A1L; GTF2A1LF
NCBI Protein Information
STON1-GTF2A1L protein
NCBI Description
STON1-GTF2A1L mRNAs are infrequent but naturally occurring read-through products of the neighboring STON1 and GTF2A1L genes. These transcripts encode fusion proteins composed of the vast majority of each of the individual elements, stonin 1 and general transcription factor IIA, 1-like. Alternative splicing results in multiple transcript variants. The significance of these read-through variants and the function of the resulting protein products have not yet been determined. [provided by RefSeq, Oct 2010]
Similar Products
Product Notes
The STON1-GTF2A1L (Catalog #AAA3200471) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SALF antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's SALF can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the STON1-GTF2A1L for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NSGDDVSEQD VPDLFDTDNV IVCQYDKIHR SKNKWKFYLK DGVMCFGGRD. It is sometimes possible for the material contained within the vial of "SALF, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
