Testing Data
()
CD302 recombinant protein
CD302 Recombinant Protein
Gene Names
CD302; DCL1; DCL-1; BIMLEC; CLEC13A
Purity
Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is >85% (by SDS-PAGE).
Synonyms
CD302; CD302 Recombinant Protein; CD302 recombinant protein
Host
E Coli
Purity/Purification
Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is >85% (by SDS-PAGE).
Form/Format
PBS, 4M Urea, PH7.4
Concentration
>=0.5mg/ml (varies by lot)
Sequence
DCPSSTWIQFQDSCYIFLQEAIKVESIEDVRNQCTDHGADMISIHNEEENAFILDTLKKQWKGPDDILLGMFYDTDDASFKWFDNSNMTFDKWTDQDDDEDLVDTCAFLHIKTGEWKKGNCEVSSVEGTLCKTAIPYKRKYLSDNH
Tag
His-tag in C-terminal
Expression Vector
pet-22b(+)
BP
450
Restriction Site
NdeI-XhoI
Preparation and Storage
Store at 4 degee C for short term. Aliquot and store at -20 degee C long term. Avoid freeze-thaw cycles.
Testing Data
()
Testing Data
()
Related Product Information for CD302 recombinant protein
Background: CD302, potential multifunctional C-type lectin receptor that may play roles in endocytosis and phagocytosis as well as in cell adhesion and migration.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
26,183 Da
NCBI Official Full Name
CD302 antigen isoform 2
NCBI Official Synonym Full Names
CD302 molecule
NCBI Official Symbol
CD302
NCBI Official Synonym Symbols
DCL1; DCL-1; BIMLEC; CLEC13A
NCBI Protein Information
CD302 antigen; DEC205-associated C-type lectin 1; C-type lectin domain family 13, member A; type I transmembrane C-type lectin receptor DCL-1
UniProt Protein Name
CD302 antigen
Protein Family
UniProt Gene Name
CD302
UniProt Synonym Gene Names
CLEC13A; DCL1; KIAA0022
UniProt Entry Name
CD302_HUMAN
NCBI Description
CD302 is a C-type lectin receptor involved in cell adhesion and migration, as well as endocytosis and phagocytosis (Kato et al., 2007 [PubMed 17947679]).[supplied by OMIM, Aug 2008]
Uniprot Description
CD302: Potential multifunctional C-type lectin receptor that may play roles in endocytosis and phagocytosis as well as in cell adhesion and migration. 5 isoforms of the human protein are produced by alternative splicing.
Protein type: Membrane protein, integral
Chromosomal Location of Human Ortholog: 2q24.2
Cellular Component: microvillus; membrane; integral to membrane; cell cortex; filopodium
Molecular Function: carbohydrate binding
Biological Process: phagocytosis
Research Articles on CD302
Similar Products
Product Notes
The CD302 cd302 (Catalog #AAA3003581) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: DCPSSTWIQF QDSCYIFLQE AIKVESIEDV RNQCTDHGAD MISIHNEEEN AFILDTLKKQ WKGPDDILLG MFYDTDDASF KWFDNSNMTF DKWTDQDDDE DLVDTCAFLH IKTGEWKKGN CEVSSVEGTL CKTAIPYKRK YLSDNH. It is sometimes possible for the material contained within the vial of "CD302, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
