Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-PLA2G4B Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human brain)

Rabbit PLA2G4B Polyclonal Antibody | anti-JMJD7-PLA2G4B antibody

PLA2G4B antibody - N-terminal region

Gene Names
PLA2G4B; HsT16992; cPLA2-beta
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PLA2G4B; Polyclonal Antibody; PLA2G4B antibody - N-terminal region; anti-JMJD7-PLA2G4B antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KDHYENLYCVVSGEKHFLFHPPSDRPFIPYELYTPATYQLTEEGTFKVVD
Sequence Length
1012
Applicable Applications for anti-JMJD7-PLA2G4B antibody
Western Blot (WB)
Homology
Cow: 85%; Dog: 86%; Guinea Pig: 93%; Horse: 92%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human PLA2G4B
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-PLA2G4B Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human brain)

Western Blot (WB) (WB Suggested Anti-PLA2G4B Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human brain)
Related Product Information for anti-JMJD7-PLA2G4B antibody
This is a rabbit polyclonal antibody against PLA2G4B. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: This gene transcribes naturally-occurring mRNAs that are co-transcribed products of the neighboring JMJD7 and PLA2G4B genes. Incompletely processed read-through transcripts from these two loci are abundantly expressed in most tissues, but the function of the predicted protein product has not yet been determined. Alternative splicing of this gene results in different transcript variants, some of which are candidates for nonsense-mediated decay (NMD).The LOC100137047-PLA2G4B mRNAs are naturally occurring co-transcribed products of the neighboring LOC100137047 and PLA2G4B genes. Incompletely processed read-through transcripts from these two loci are abundantly expressed in most tissues, but the function of the predicted protein product has not yet been determined. Alternative splicing of this gene results in different transcript variants, some of which are candidates for nonsense-mediated decay (NMD).
Product Categories/Family for anti-JMJD7-PLA2G4B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
114kDa
NCBI Official Full Name
cytosolic phospholipase A2 beta
NCBI Official Synonym Full Names
phospholipase A2 group IVB
NCBI Official Symbol
PLA2G4B
NCBI Official Synonym Symbols
HsT16992; cPLA2-beta
NCBI Protein Information
cytosolic phospholipase A2 beta
UniProt Protein Name
Cytosolic phospholipase A2 beta
UniProt Gene Name
PLA2G4B
UniProt Synonym Gene Names
cPLA2-beta
UniProt Entry Name
PA24B_HUMAN

NCBI Description

This gene encodes a member of the cytosolic phospholipase A2 protein family. Phospholipase A2 enzymes hydrolyze the sn-2 bond of phospholipids, releasing lysophospholipids and fatty acids. This enzyme may be associated with mitochondria and early endosomes. Most tissues also express read-through transcripts from the upstream gene into this gene, some of which may encode fusion proteins combining the N-terminus of the upstream gene including its JmjC domain with the almost complete coding region of this gene, including the C2 and cytoplasmic phospholipase A2 domains. [provided by RefSeq, Jul 2008]

Uniprot Description

PLA2G4B: a calcium-dependent phospholipase A2 that catalyzes the release of arachidonic acid from membrane phospholipids. Selectively hydrolyzes glycerophospholipids in the sn-2 position with a preference for arachidonoyl phospholipids. Has a much weaker activity than PLA2G4A. Not inhibited by pyrrolidine-2 and Wyeth-1. The N-terminal C2 domain associates with lipid membranes and mediates its regulation by presenting the active site to its substrate in response to elevations of cytosolic Ca2+. Four isoforms of the human protein are produced by alternative splicing. Isoform 3 translocates to membrane vesicles in a calcium-dependent fashion and has activity against palmitoyl-arachidonyl-phosphatidylethanolamine and low level lysophospholipase activity but no activity against phosphatidylcholine.

Protein type: Phospholipase; EC 3.1.1.4; Lipid Metabolism - arachidonic acid

Chromosomal Location of Human Ortholog: 15q11.2-q21.3

Cellular Component: early endosome membrane; mitochondrial inner membrane; extracellular region; cytosol

Molecular Function: calcium-dependent phospholipid binding; calcium-dependent phospholipase A2 activity; calcium ion binding; lysophospholipase activity

Biological Process: unfolded protein response, activation of signaling protein activity; cellular protein metabolic process; unfolded protein response; glycerophospholipid catabolic process; phospholipid metabolic process; glycerophospholipid biosynthetic process; calcium-mediated signaling; arachidonic acid metabolic process; phosphatidic acid biosynthetic process; parturition; inflammatory response

Research Articles on JMJD7-PLA2G4B

Similar Products

Product Notes

The JMJD7-PLA2G4B pla2g4b (Catalog #AAA3202735) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PLA2G4B antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PLA2G4B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the JMJD7-PLA2G4B pla2g4b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KDHYENLYCV VSGEKHFLFH PPSDRPFIPY ELYTPATYQL TEEGTFKVVD. It is sometimes possible for the material contained within the vial of "PLA2G4B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.