Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-GTF2A1L Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Placenta)

Rabbit GTF2A1L Polyclonal Antibody | anti-GTF2A1L antibody

GTF2A1L antibody - C-terminal region

Gene Names
GTF2A1L; ALF
Reactivity
Cow, Dog, Horse, Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
GTF2A1L; Polyclonal Antibody; GTF2A1L antibody - C-terminal region; anti-GTF2A1L antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EFLGNIDGGDLKVPEEEADSISNEDSATNSSDNEDPQVNIVEEDPLNSGD
Sequence Length
453
Applicable Applications for anti-GTF2A1L antibody
Western Blot (WB)
Homology
Cow: 79%; Dog: 86%; Horse: 86%; Human: 100%; Mouse: 79%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human GTF2A1L
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-GTF2A1L Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Placenta)

Western Blot (WB) (WB Suggested Anti-GTF2A1L Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Placenta)
Related Product Information for anti-GTF2A1L antibody
This is a rabbit polyclonal antibody against GTF2A1L. It was validated on Western Blot

Target Description: The assembly and stability of the RNA polymerase II transcription pre-initiation complex on a eukaryotic core promoter involve the effects of TFIIA on the interaction between TATA-binding protein (TBP) and DNA. This gene encodes a germ cell-specific counterpart of the large (alpha/beta) subunit of general transcription factor TFIIA that is able to stabilize the binding of TBP to DNA and may be uniquely important to testis biology.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
49kDa
NCBI Official Synonym Full Names
general transcription factor IIA subunit 1 like
NCBI Official Symbol
GTF2A1L
NCBI Official Synonym Symbols
ALF
NCBI Protein Information
TFIIA-alpha and beta-like factor
UniProt Protein Name
TFIIA-alpha and beta-like factor
UniProt Gene Name
GTF2A1L
UniProt Synonym Gene Names
ALF; GTF2A1LF
UniProt Entry Name
TF2AY_HUMAN

NCBI Description

The assembly and stability of the RNA polymerase II transcription pre-initiation complex on a eukaryotic core promoter involve the effects of transcription factor IIA (TFIIA) on the interaction between TATA-binding protein (TBP) and DNA. This gene encodes a germ cell-specific counterpart of the large (alpha/beta) subunit of general transcription factor TFIIA that is able to stabilize the binding of TBP to DNA and may be uniquely important to testis biology. Alternative splicing for this locus has been observed and two variants, encoding distinct isoforms, have been identified. Co-transcription of this gene and the neighboring upstream gene generates a rare transcript (SALF), which encodes a fusion protein comprised of sequence sharing identity with each individual gene product. [provided by RefSeq, Mar 2014]

Research Articles on GTF2A1L

Similar Products

Product Notes

The GTF2A1L gtf2a1l (Catalog #AAA3211548) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GTF2A1L antibody - C-terminal region reacts with Cow, Dog, Horse, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's GTF2A1L can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GTF2A1L gtf2a1l for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EFLGNIDGGD LKVPEEEADS ISNEDSATNS SDNEDPQVNI VEEDPLNSGD. It is sometimes possible for the material contained within the vial of "GTF2A1L, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.