Western Blot (WB)
(WB Suggested Anti-RPAIN Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 293T cell lysateRPAIN is supported by BioGPS gene expression data to be expressed in HEK293T)
Rabbit RPAIN Polyclonal Antibody | anti-RPAIN antibody
RPAIN antibody - C-terminal region
Gene Names
RPAIN; RIP; HRIP
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
RPAIN; Polyclonal Antibody; RPAIN antibody - C-terminal region; anti-RPAIN antibody
Host
Rabbit
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VVCQCGLSIPSHSSELTEQKLRACLEGSINEHSAHCPHTPEFSVTGGTEE
Sequence Length
219
Applicable Applications for anti-RPAIN antibody
Western Blot (WB)
Homology
Cow: 85%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 79%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human RPAIN
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-RPAIN Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 293T cell lysateRPAIN is supported by BioGPS gene expression data to be expressed in HEK293T)
Western Blot (WB)
(WB Suggested Anti-RPAIN Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 293T cell lysateRPAIN is supported by BioGPS gene expression data to be expressed in HEK293T)
Related Product Information for anti-RPAIN antibody
This is a rabbit polyclonal antibody against RPAIN. It was validated on Western Blot
Target Description: RPAIN mediates the import of RPA complex into the nucleus, possibly via some interaction with importin beta. Isoform 2 is sumoylated and mediates the localization of RPA complex into the PML body of the nucleus, thereby participating in RPA function in DNA metabolism.
Target Description: RPAIN mediates the import of RPA complex into the nucleus, possibly via some interaction with importin beta. Isoform 2 is sumoylated and mediates the localization of RPA complex into the PML body of the nucleus, thereby participating in RPA function in DNA metabolism.
Product Categories/Family for anti-RPAIN antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25kDa
NCBI Official Full Name
RPA-interacting protein isoform b
NCBI Official Synonym Full Names
RPA interacting protein
NCBI Official Symbol
RPAIN
NCBI Official Synonym Symbols
RIP; HRIP
NCBI Protein Information
RPA-interacting protein
UniProt Protein Name
RPA-interacting protein
Protein Family
UniProt Gene Name
RPAIN
UniProt Synonym Gene Names
RIP; hRIP
UniProt Entry Name
RIP_HUMAN
Uniprot Description
RPAIN: Mediates the import of RPA complex into the nucleus, possibly via some interaction with importin beta. Isoform 2 is sumoylated and mediates the localization of RPA complex into the PML body of the nucleus, thereby participating in RPA function in DNA metabolism. 7 isoforms of the human protein are produced by alternative splicing.
Protein type: DNA repair, damage; DNA replication
Chromosomal Location of Human Ortholog: 17p13.2
Cellular Component: PML body; cytoplasm; nucleolus; nucleus
Molecular Function: metal ion binding; protein complex binding
Biological Process: protein import into nucleus; DNA-dependent DNA replication; DNA repair; response to UV; DNA recombination
Research Articles on RPAIN
Similar Products
Product Notes
The RPAIN rpain (Catalog #AAA3206093) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RPAIN antibody - C-terminal region reacts with Cow, Guinea Pig, Horse, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's RPAIN can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RPAIN rpain for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VVCQCGLSIP SHSSELTEQK LRACLEGSIN EHSAHCPHTP EFSVTGGTEE. It is sometimes possible for the material contained within the vial of "RPAIN, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
