Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: Rnf216Sample Type: Mouse Thymus lysatesAntibody Dilution: 1.0ug/ml)

Rabbit Rnf216 Polyclonal Antibody | anti-RNF216 antibody

Rnf216 Antibody - N-terminal region

Gene Names
Rnf216; UIP83; C86502; TRIAD3; AI647468; AU019462; Ubce7ip1; 2810055G22Rik; F830018F18Rik
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Rnf216; Polyclonal Antibody; Rnf216 Antibody - N-terminal region; anti-RNF216 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: IVNPRLEQKVIILGENGLLFPESEPLEVQNQSSEDSETELLSNPGEPAAS
Sequence Length
853
Applicable Applications for anti-RNF216 antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 86%; Rabbit: 93%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of MOUSE Rnf216
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: Rnf216Sample Type: Mouse Thymus lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: Rnf216Sample Type: Mouse Thymus lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-RNF216 antibody
This is a rabbit polyclonal antibody against Rnf216. It was validated on Western Blot

Target Description: Rnf216 acts as an E3 ubiquitin ligase, which accepts ubiquitin from specific E2 ubiquitin-conjugating enzymes, and then transfers it to substrates promoting their degradation by the proteasome. It promotes degradation of TRAF3, TLR4 and TLR9. It contributes to the regulation of antiviral responses. It down-regulates activation of NF-kappa-B, IRF3 activation and IFNB production and promotes TNF and RIP mediated apoptosis.
Product Categories/Family for anti-RNF216 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
93kDa
NCBI Official Full Name
E3 ubiquitin-protein ligase RNF216 isoform A
NCBI Official Synonym Full Names
ring finger protein 216
NCBI Official Symbol
Rnf216
NCBI Official Synonym Symbols
UIP83; C86502; TRIAD3; AI647468; AU019462; Ubce7ip1; 2810055G22Rik; F830018F18Rik
NCBI Protein Information
E3 ubiquitin-protein ligase RNF216
UniProt Protein Name
E3 ubiquitin-protein ligase RNF216
UniProt Gene Name
Rnf216
UniProt Synonym Gene Names
Triad3; Ubce7ip1; Uip83; Zin
UniProt Entry Name
RN216_MOUSE

Uniprot Description

TRIAD3: Isoform 1 acts as an E3 ubiquitin ligase, which accepts ubiquitin from specific E2 ubiquitin-conjugating enzymes, and then transfers it to substrates promoting their degradation by the proteasome. Promotes degradation of TRAF3, TLR4 and TLR9. Contributes to the regulation of antiviral responses. Down- regulates activation of NF-kappa-B, IRF3 activation and IFNB production. Isoform 3/ZIN inhibits TNF and IL-1 mediated activation of NF-kappa-B. Promotes TNF and RIP mediated apoptosis. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Ubiquitin ligase; EC 6.3.2.19; Ligase; Ubiquitin conjugating system; EC 6.3.2.-

Cellular Component: nucleoplasm; cytoplasm; nucleus

Molecular Function: zinc ion binding; coenzyme F420-2 alpha-glutamyl ligase activity; metal ion binding; UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6-diaminopimelate-D-alanyl-D-alanine ligase activity; ribosomal S6-glutamic acid ligase activity; coenzyme F420-0 gamma-glutamyl ligase activity; ligase activity

Biological Process: proteasomal ubiquitin-dependent protein catabolic process; apoptosis; regulation of interferon-beta production; regulation of defense response to virus by host

Research Articles on RNF216

Similar Products

Product Notes

The RNF216 rnf216 (Catalog #AAA3213582) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Rnf216 Antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Rnf216 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RNF216 rnf216 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IVNPRLEQKV IILGENGLLF PESEPLEVQN QSSEDSETEL LSNPGEPAAS. It is sometimes possible for the material contained within the vial of "Rnf216, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.