Rabbit anti-Human RhoB Polyclonal Antibody | anti-RhoB antibody

RhoB (ARH6, ARHB, RHOH6, Ras Homolog Family Member B, ARH6, Aplysia Ras-related Homolog 6, ARHB, RhoH6) APC

Cat. Num. AAA6392519

• Gene Names: RHOB; ARH6; ARHB; RHOH6; MST081; MSTP081
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: RhoB; Polyclonal Antibody; RhoB (ARH6; ARHB; RHOH6; Ras Homolog Family Member B; ARH6; Aplysia Ras-related Homolog 6; RhoH6) APC; anti-RhoB antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human RHOB.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).

• Applicable Applications for anti-RhoB antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human RHOB, aa1-196 (NP_004031.1).
• Immunogen Sequence: MAAIRKKLVVVGDGACGKTCLLIVFSKDEFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWVPEVKHFCPNVPIILVANKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYDYLECSAKTKEGVREVFETATRAALQKRYGSQNGCINCCKVL
• Conjugate: APC
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of RHOB expression in transfected 293T cell line by RHOB polyclonal antibody. Lane 1: RHOB transfected lysate (22.1kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-RhoB antibody

RhoB mediates apoptosis in neoplastically transformed cells after DNA damage. Not essential for development but affects cell adhesion and growth factor signaling in transformed cells. Plays a negative role in tumorigenesis as deletion causes tumor formation. Involved in intracellular protein trafficking of a number of proteins. Targets PKN1 to endosomes and is involved in trafficking of the EGF receptor from late endosomes to lysosomes. Also required for stability and nuclear trafficking of AKT1/AKT which promotes endothelial cell survival during vascular development.

Product Categories/Family for anti-RhoB antibody

Antibodies; GTPase; Rab; Ras; Rho Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 4757764
• NCBI GeneID: 388
• NCBI Accession #: NP_004031.1
• NCBI GenBank Nucleotide #: NM_004040
• UniProt Accession #: P62745; P01121; Q5U0H6; Q7RTN5; Q7RTR9; Q9CUV7; B2R692
• Molecular Weight: 22,123 Da
• NCBI Official Full Name: rho-related GTP-binding protein RhoB
• NCBI Official Synonym Full Names: ras homolog family member B
• NCBI Official Symbol: RHOB
• NCBI Official Synonym Symbols: ARH6; ARHB; RHOH6; MST081; MSTP081
• NCBI Protein Information: rho-related GTP-binding protein RhoB; h6; oncogene RHO H6; rho cDNA clone 6; Aplysia RAS-related homolog 6; ras homolog gene family, member B
• UniProt Protein Name: Rho-related GTP-binding protein RhoB
• Protein Family: Rho-related GTP-binding protein
• UniProt Gene Name: RHOB
• UniProt Synonym Gene Names: ARH6; ARHB; h6
• UniProt Entry Name: RHOB_HUMAN

Uniprot Description

RHOB: a small G protein of the Rho family. Regulates a signal transduction pathway linking plasma membrane receptors to the assembly of focal adhesions and actin stress fibers. Controls the reorganization of actins into podosomes. Serves as a target for the yopT cysteine peptidase from Yersinia pestis, vector of the plague, and Yersinia pseudotuberculosis, which causes gastrointestinal disorders.

Protein type: Tumor suppressor; G protein, monomeric; G protein, monomeric, Rho; Motility/polarity/chemotaxis; G protein

Chromosomal Location of Human Ortholog: 2p24

Cellular Component: focal adhesion; late endosome membrane; early endosome; plasma membrane; endosome membrane; nucleus; cytosol; cleavage furrow

Molecular Function: GTPase activity; protein binding; GDP binding; GTP binding

Biological Process: axon guidance; platelet activation; transformed cell apoptosis; metabolic process; apoptosis; positive regulation of apoptosis; cytokinesis; Rho protein signal transduction; negative regulation of cell cycle; intracellular protein transport; positive regulation of angiogenesis; regulation of small GTPase mediated signal transduction; small GTPase mediated signal transduction; endosome to lysosome transport; angiogenesis; blood coagulation; cell adhesion