Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of RHOB expression in transfected 293T cell line by RHOB polyclonal antibody. Lane 1: RHOB transfected lysate (22.1kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human RhoB Polyclonal Antibody | anti-RhoB antibody

RhoB (ARH6, ARHB, RHOH6, Ras Homolog Family Member B, ARH6, Aplysia Ras-related Homolog 6, ARHB, RhoH6) (Biotin)

Gene Names
RHOB; ARH6; ARHB; RHOH6; MST081; MSTP081
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RhoB; Polyclonal Antibody; RhoB (ARH6; ARHB; RHOH6; Ras Homolog Family Member B; ARH6; Aplysia Ras-related Homolog 6; RhoH6) (Biotin); anti-RhoB antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human RHOB.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-RhoB antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human RHOB, aa1-196 (NP_004031.1).
Immunogen Sequence
MAAIRKKLVVVGDGACGKTCLLIVFSKDEFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWVPEVKHFCPNVPIILVANKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYDYLECSAKTKEGVREVFETATRAALQKRYGSQNGCINCCKVL
Conjugate
Biotin
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of RHOB expression in transfected 293T cell line by RHOB polyclonal antibody. Lane 1: RHOB transfected lysate (22.1kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of RHOB expression in transfected 293T cell line by RHOB polyclonal antibody. Lane 1: RHOB transfected lysate (22.1kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-RhoB antibody
RhoB mediates apoptosis in neoplastically transformed cells after DNA damage. Not essential for development but affects cell adhesion and growth factor signaling in transformed cells. Plays a negative role in tumorigenesis as deletion causes tumor formation. Involved in intracellular protein trafficking of a number of proteins. Targets PKN1 to endosomes and is involved in trafficking of the EGF receptor from late endosomes to lysosomes. Also required for stability and nuclear trafficking of AKT1/AKT which promotes endothelial cell survival during vascular development.
Product Categories/Family for anti-RhoB antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
388
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22,123 Da
NCBI Official Full Name
rho-related GTP-binding protein RhoB
NCBI Official Synonym Full Names
ras homolog family member B
NCBI Official Symbol
RHOB
NCBI Official Synonym Symbols
ARH6; ARHB; RHOH6; MST081; MSTP081
NCBI Protein Information
rho-related GTP-binding protein RhoB; h6; oncogene RHO H6; rho cDNA clone 6; Aplysia RAS-related homolog 6; ras homolog gene family, member B
UniProt Protein Name
Rho-related GTP-binding protein RhoB
UniProt Gene Name
RHOB
UniProt Synonym Gene Names
ARH6; ARHB; h6
UniProt Entry Name
RHOB_HUMAN

Uniprot Description

RHOB: a small G protein of the Rho family. Regulates a signal transduction pathway linking plasma membrane receptors to the assembly of focal adhesions and actin stress fibers. Controls the reorganization of actins into podosomes. Serves as a target for the yopT cysteine peptidase from Yersinia pestis, vector of the plague, and Yersinia pseudotuberculosis, which causes gastrointestinal disorders.

Protein type: Tumor suppressor; G protein, monomeric; G protein, monomeric, Rho; Motility/polarity/chemotaxis; G protein

Chromosomal Location of Human Ortholog: 2p24

Cellular Component: focal adhesion; late endosome membrane; early endosome; plasma membrane; endosome membrane; nucleus; cytosol; cleavage furrow

Molecular Function: GTPase activity; protein binding; GDP binding; GTP binding

Biological Process: axon guidance; platelet activation; transformed cell apoptosis; metabolic process; apoptosis; positive regulation of apoptosis; cytokinesis; Rho protein signal transduction; negative regulation of cell cycle; intracellular protein transport; positive regulation of angiogenesis; regulation of small GTPase mediated signal transduction; small GTPase mediated signal transduction; endosome to lysosome transport; angiogenesis; blood coagulation; cell adhesion

Research Articles on RhoB

Similar Products

Product Notes

The RhoB rhob (Catalog #AAA6392520) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RhoB (ARH6, ARHB, RHOH6, Ras Homolog Family Member B, ARH6, Aplysia Ras-related Homolog 6, ARHB, RhoH6) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RhoB can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RhoB rhob for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RhoB, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.