<
Western Blot (WB)
(Host: RabbitTarget Name: RHBDF1Sample Tissue: Human 786-0 Whole CellAntibody Dilution: 1ug/ml)
Rabbit RHBDF1 Polyclonal Antibody | anti-RHBDF1 antibody
RHBDF1 antibody - N-terminal region
Gene Names
RHBDF1; Dist1; hDist1; C16orf8; EGFR-RS; gene-89; gene-90
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
RHBDF1; Polyclonal Antibody; RHBDF1 antibody - N-terminal region; anti-RHBDF1 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KDWEKAPEQADLTGGALDRSELERSHLMLPLERGWRKQKEGAAAPQPKVR
Sequence Length
855
Applicable Applications for anti-RHBDF1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human RHBDF1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: RHBDF1Sample Tissue: Human 786-0 Whole CellAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: RHBDF1Sample Tissue: Human 786-0 Whole CellAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: RHBDF1Sample Tissue: Human PANC1 Whole CellAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: RHBDF1Sample Tissue: Human PANC1 Whole CellAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: RHBDF1Sample Tissue: Human PANC1 Whole CellAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: RHBDF1Sample Tissue: Human PANC1 Whole CellAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: RHBDF1Sample Type: 721_B Whole CellLane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 1ug/mlPeptide Concentration: 5ug/mlLysate Quantity: 25ug/lane/LaneGel Concentration: 0.12)
Western Blot (WB)
(Host: RabbitTarget Name: RHBDF1Sample Type: 721_B Whole CellLane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 1ug/mlPeptide Concentration: 5ug/mlLysate Quantity: 25ug/lane/LaneGel Concentration: 0.12)
Western Blot (WB)
(WB Suggested Anti-RHBDF1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 721_B cell lysate)
Western Blot (WB)
(WB Suggested Anti-RHBDF1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 721_B cell lysate)
Related Product Information for anti-RHBDF1 antibody
This is a rabbit polyclonal antibody against RHBDF1. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: RHBDF1 is a seven-transmembrane protein with a long N-terminal cytoplasmic extension that comprises half of the polypeptide sequence, and is found in the endoplasmic reticulum and Golgi, but not on the cell surface. RHBDF1 has a pivotal role in sustaining growth signals in epithelial cancer cells and thus may serve as a therapeutic target for treating epithelial cancers.
Target Description: RHBDF1 is a seven-transmembrane protein with a long N-terminal cytoplasmic extension that comprises half of the polypeptide sequence, and is found in the endoplasmic reticulum and Golgi, but not on the cell surface. RHBDF1 has a pivotal role in sustaining growth signals in epithelial cancer cells and thus may serve as a therapeutic target for treating epithelial cancers.
Product Categories/Family for anti-RHBDF1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
97kDa
NCBI Official Full Name
inactive rhomboid protein 1
NCBI Official Synonym Full Names
rhomboid 5 homolog 1
NCBI Official Symbol
RHBDF1
NCBI Official Synonym Symbols
Dist1; hDist1; C16orf8; EGFR-RS; gene-89; gene-90
NCBI Protein Information
inactive rhomboid protein 1
UniProt Protein Name
Inactive rhomboid protein 1
UniProt Gene Name
RHBDF1
UniProt Synonym Gene Names
C16orf8; DIST1; IRHOM1; iRhom1
UniProt Entry Name
RHDF1_HUMAN
Research Articles on RHBDF1
Similar Products
Product Notes
The RHBDF1 rhbdf1 (Catalog #AAA3209594) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RHBDF1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's RHBDF1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RHBDF1 rhbdf1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KDWEKAPEQA DLTGGALDRS ELERSHLMLP LERGWRKQKE GAAAPQPKVR. It is sometimes possible for the material contained within the vial of "RHBDF1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
