Western Blot (WB)
(WB Suggested Anti-MPZL1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: PANC1 cell lysateThere is BioGPS gene expression data showing that MPZL1 is expressed in PANC1)
Rabbit MPZL1 Polyclonal Antibody | anti-MPZL1 antibody
MPZL1 antibody - middle region
Gene Names
MPZL1; PZR; PZRa; PZRb; PZR1b; MPZL1b
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
MPZL1; Polyclonal Antibody; MPZL1 antibody - middle region; anti-MPZL1 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ISWAGDLDKKDASINIENMQFIHNGTYICDVKNPPDIVVQPGHIRLYVVE
Sequence Length
209
Applicable Applications for anti-MPZL1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human MPZL1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-MPZL1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: PANC1 cell lysateThere is BioGPS gene expression data showing that MPZL1 is expressed in PANC1)
Western Blot (WB)
(WB Suggested Anti-MPZL1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: PANC1 cell lysateThere is BioGPS gene expression data showing that MPZL1 is expressed in PANC1)
Related Product Information for anti-MPZL1 antibody
This is a rabbit polyclonal antibody against MPZL1. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: MPZL1 is a cell surface receptor, which is involved in signal transduction processes. MPZL1 recruits PTPN11/SHP-2 to the cell membrane and is a putative substrate of PTPN11/SHP-2. MPZL1 is a major receptor for concanavalin A (ConA) and is involved in cell
Target Description: MPZL1 is a cell surface receptor, which is involved in signal transduction processes. MPZL1 recruits PTPN11/SHP-2 to the cell membrane and is a putative substrate of PTPN11/SHP-2. MPZL1 is a major receptor for concanavalin A (ConA) and is involved in cell
Product Categories/Family for anti-MPZL1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23kDa
NCBI Official Full Name
myelin protein zero-like protein 1 isoform b
NCBI Official Synonym Full Names
myelin protein zero like 1
NCBI Official Symbol
MPZL1
NCBI Official Synonym Symbols
PZR; PZRa; PZRb; PZR1b; MPZL1b
NCBI Protein Information
myelin protein zero-like protein 1
UniProt Protein Name
Myelin protein zero-like protein 1
Protein Family
UniProt Gene Name
MPZL1
UniProt Synonym Gene Names
PZR
UniProt Entry Name
MPZL1_HUMAN
Uniprot Description
PZR: an immunoglobulin superfamily cell surface protein. Contains two tyrosine-based inhibition motifs (ITIMs) responsible for binding of SHP-2. When phosphorylated, it can specifically bind SHP-2, blocking its translocation, and interupting its function. Treatment of several cell lines with ConA caused tyrosine phosphorylation of PZR. Two alternatively spliced isoforms have been reported. One isoform, PZR1b, lacks the ITIMs and has a dominant negative effect upon full-length PZR and its recruitment of SHP-2.
Protein type: Adaptor/scaffold; Membrane protein, integral
Chromosomal Location of Human Ortholog: 1q24.2
Cellular Component: focal adhesion; cell surface; integral to plasma membrane
Molecular Function: protein binding; structural molecule activity
Biological Process: cell-cell signaling; transmembrane receptor protein tyrosine kinase signaling pathway
Research Articles on MPZL1
Similar Products
Product Notes
The MPZL1 mpzl1 (Catalog #AAA3208189) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MPZL1 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's MPZL1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MPZL1 mpzl1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ISWAGDLDKK DASINIENMQ FIHNGTYICD VKNPPDIVVQ PGHIRLYVVE. It is sometimes possible for the material contained within the vial of "MPZL1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
