Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-SEC22C Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: PANC1 cell lysate)

Rabbit SEC22C Polyclonal Antibody | anti-SEC22C antibody

SEC22C antibody - middle region

Gene Names
SEC22C; SEC22L3
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SEC22C; Polyclonal Antibody; SEC22C antibody - middle region; anti-SEC22C antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FRMEPVTALGILSLILNIMCAALNLIRGVHLAEHSLQVAHEEIGNILAFL
Sequence Length
303
Applicable Applications for anti-SEC22C antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 86%; Pig: 100%; Rabbit: 100%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SEC22C
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-SEC22C Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: PANC1 cell lysate)

Western Blot (WB) (WB Suggested Anti-SEC22C Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: PANC1 cell lysate)
Related Product Information for anti-SEC22C antibody
This is a rabbit polyclonal antibody against SEC22C. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The protein encoded by this gene is a member of the SEC22 family of vesicle trafficking proteins. It is localized at the endoplasmic reticulum and it is thought to play a role in the early stages of the ER-Golgi protein trafficking. There are two alternat
Product Categories/Family for anti-SEC22C antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34kDa
NCBI Official Full Name
vesicle-trafficking protein SEC22c isoform a
NCBI Official Synonym Full Names
SEC22 homolog C, vesicle trafficking protein
NCBI Official Symbol
SEC22C
NCBI Official Synonym Symbols
SEC22L3
NCBI Protein Information
vesicle-trafficking protein SEC22c
UniProt Protein Name
Vesicle-trafficking protein SEC22c
UniProt Gene Name
SEC22C
UniProt Synonym Gene Names
SEC22L3
UniProt Entry Name
SC22C_HUMAN

NCBI Description

This gene encodes a member of the SEC22 family of vesicle trafficking proteins. The encoded protein is localized to the endoplasmic reticulum and may play a role in the early stages of ER-Golgi protein trafficking. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jan 2011]

Uniprot Description

SEC22C: May be involved in vesicle transport between the ER and the Golgi complex. Belongs to the synaptobrevin family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, multi-pass; Membrane protein, integral

Chromosomal Location of Human Ortholog: 3p22.1

Cellular Component: SNARE complex; endoplasmic reticulum membrane; endoplasmic reticulum; integral to membrane

Molecular Function: SNAP receptor activity; SNARE binding

Biological Process: ER to Golgi vesicle-mediated transport; protein transport; exocytosis; vesicle fusion with Golgi apparatus

Research Articles on SEC22C

Similar Products

Product Notes

The SEC22C sec22c (Catalog #AAA3209812) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SEC22C antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SEC22C can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SEC22C sec22c for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FRMEPVTALG ILSLILNIMC AALNLIRGVH LAEHSLQVAH EEIGNILAFL. It is sometimes possible for the material contained within the vial of "SEC22C, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.