Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-RDBP Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Spleen)

Rabbit RDBP Polyclonal Antibody | anti-NELFE antibody

RDBP antibody - N-terminal region

Gene Names
NELFE; RD; RDP; RDBP; D6S45; NELF-E
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
RDBP; Polyclonal Antibody; RDBP antibody - N-terminal region; anti-NELFE antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QSSSSTTSQGGVKRSLSEQPVMDTATATEQAKQLVKSGAISAIKAETKNS
Sequence Length
380
Applicable Applications for anti-NELFE antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human RDBP
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-RDBP Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Spleen)

Western Blot (WB) (WB Suggested Anti-RDBP Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Spleen)
Related Product Information for anti-NELFE antibody
This is a rabbit polyclonal antibody against RDBP. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: RDBP is part of a complex termed negative elongation factor (NELF) which represses RNA polymerase II transcript elongation. This protein bears similarity to nuclear RNA-binding proteins; however, it has not been demonstrated that this protein binds RNA. The protein contains a tract of alternating basic and acidic residues, largely arginine (R) and aspartic acid (D). The protein encoded by this gene is part of a complex termed negative elongation factor (NELF) which represses RNA polymerase II transcript elongation. This protein bears similarity to nuclear RNA-binding proteins; however, it has not been demonstrated that this protein binds RNA. The protein contains a tract of alternating basic and acidic residues, largely arginine (R) and aspartic acid (D). The gene localizes to the major histocompatibility complex (MHC) class III region on chromosome 6. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43kDa
NCBI Official Full Name
negative elongation factor E
NCBI Official Synonym Full Names
negative elongation factor complex member E
NCBI Official Symbol
NELFE
NCBI Official Synonym Symbols
RD; RDP; RDBP; D6S45; NELF-E
NCBI Protein Information
negative elongation factor E
UniProt Protein Name
Negative elongation factor E
UniProt Gene Name
NELFE
UniProt Synonym Gene Names
RD; RDBP; NELF-E
UniProt Entry Name
NELFE_HUMAN

NCBI Description

The protein encoded by this gene is part of a complex termed negative elongation factor (NELF) which represses RNA polymerase II transcript elongation. This protein bears similarity to nuclear RNA-binding proteins; however, it has not been demonstrated that this protein binds RNA. The protein contains a tract of alternating basic and acidic residues, largely arginine (R) and aspartic acid (D). The gene localizes to the major histocompatibility complex (MHC) class III region on chromosome 6. [provided by RefSeq, Jul 2008]

Uniprot Description

RDBP: Essential component of the NELF complex, a complex that negatively regulates the elongation of transcription by RNA polymerase II. The NELF complex, which acts via an association with the DSIF complex and causes transcriptional pausing, is counteracted by the P-TEFb kinase complex. Belongs to the RRM NELF-E family.

Protein type: Transcription, coactivator/corepressor; Mitochondrial

Chromosomal Location of Human Ortholog: 6p21.3

Cellular Component: nucleoplasm; mitochondrion; nucleus

Molecular Function: protein binding; RNA binding; nucleotide binding

Biological Process: transcription from RNA polymerase II promoter; viral reproduction; positive regulation of viral transcription; RNA elongation from RNA polymerase II promoter; gene expression

Research Articles on NELFE

Similar Products

Product Notes

The NELFE nelfe (Catalog #AAA3205221) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RDBP antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's RDBP can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NELFE nelfe for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QSSSSTTSQG GVKRSLSEQP VMDTATATEQ AKQLVKSGAI SAIKAETKNS. It is sometimes possible for the material contained within the vial of "RDBP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.