Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: SPF45Sample Type: Jurkat Whole CellAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human RBM17 Polyclonal Antibody | anti-RBM17 antibody

RBM17 Antibody - Middle region

Gene Names
RBM17; SPF45
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
RBM17; Polyclonal Antibody; RBM17 Antibody - Middle region; anti-RBM17 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ERERRKRSMGGAAIAPPTSLVEKDKELPRDFPYEEDSRPRSQSSKAAIPP
Sequence Length
401
Applicable Applications for anti-RBM17 antibody
Western Blot (WB)
Immunogen
The immunogen for Anti-RBM17 antibody is: synthetic peptide directed towards the Middle region of Human SPF45
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: SPF45Sample Type: Jurkat Whole CellAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: SPF45Sample Type: Jurkat Whole CellAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-RBM17 antibody
This is a rabbit polyclonal antibody against SPF45. It was validated on Western Blot

Target Description: This gene encodes an RNA binding protein. The encoded protein is part of the spliceosome complex and functions in the second catalytic step of mRNA splicing. Alternatively spliced transcript variants have been described. Related pseudogenes exist on chromosomes 9 and 15.
Product Categories/Family for anti-RBM17 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44 kDa
NCBI Official Synonym Full Names
RNA binding motif protein 17
NCBI Official Symbol
RBM17
NCBI Official Synonym Symbols
SPF45
NCBI Protein Information
splicing factor 45
UniProt Protein Name
Splicing factor 45
Protein Family
UniProt Gene Name
RBM17
UniProt Synonym Gene Names
SPF45
UniProt Entry Name
SPF45_HUMAN

NCBI Description

This gene encodes an RNA binding protein. The encoded protein is part of the spliceosome complex and functions in the second catalytic step of mRNA splicing. Alternatively spliced transcript variants have been described. Related pseudogenes exist on chromosomes 9 and 15. [provided by RefSeq, Mar 2009]

Uniprot Description

RBM17: Splice factor that binds to the single stranded 3'AG at the exon/intron border and promotes its utilization in the second catalytic step. Involved in the regulation of alternative splicing and the utilization of cryptic splice sites. Promotes the utilization of a cryptic splice site created by the beta-110 mutation in the HBB gene. The resulting frameshift leads to sickle cell anemia.

Protein type: Spliceosome; RNA-binding; RNA splicing

Chromosomal Location of Human Ortholog: 10p15.1

Cellular Component: nucleoplasm; spliceosome

Molecular Function: protein binding; RNA binding; nucleotide binding

Biological Process: alternative nuclear mRNA splicing, via spliceosome

Research Articles on RBM17

Similar Products

Product Notes

The RBM17 rbm17 (Catalog #AAA3220135) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RBM17 Antibody - Middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RBM17 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RBM17 rbm17 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ERERRKRSMG GAAIAPPTSL VEKDKELPRD FPYEEDSRPR SQSSKAAIPP. It is sometimes possible for the material contained within the vial of "RBM17, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.