Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: PRPF18Sample Type: Placenta lysatesAntibody Dilution: 1.0ug/ml)

Rabbit PRPF18 Polyclonal Antibody | anti-PRPF18 antibody

PRPF18 Antibody - middle region

Gene Names
PRPF18; PRP18; hPrp18
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PRPF18; Polyclonal Antibody; PRPF18 Antibody - middle region; anti-PRPF18 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NKGLRNDLKAALDKIDQQYLNEIVGGQEPGEEDTQNDLKVHEENTTIEEL
Sequence Length
342
Applicable Applications for anti-PRPF18 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human PRPF18
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: PRPF18Sample Type: Placenta lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: PRPF18Sample Type: Placenta lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-PRPF18 antibody
This is a rabbit polyclonal antibody against PRPF18. It was validated on Western Blot

Target Description: Pre-mRNA splicing occurs in 2 sequential transesterification steps. The protein encoded by this gene is found to be essential for the catalytic step II in pre-mRNA splicing process. It is found in the spliceosome, and contains seven WD repeats, which function in protein-protein interactions. This protein has a sequence similarity to the yeast splicing factor Prp18.
Product Categories/Family for anti-PRPF18 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40kDa
NCBI Official Full Name
pre-mRNA-splicing factor 18
NCBI Official Synonym Full Names
pre-mRNA processing factor 18
NCBI Official Symbol
PRPF18
NCBI Official Synonym Symbols
PRP18; hPrp18
NCBI Protein Information
pre-mRNA-splicing factor 18
UniProt Protein Name
Pre-mRNA-splicing factor 18
UniProt Gene Name
PRPF18
UniProt Synonym Gene Names
HPRP18; hPRP18
UniProt Entry Name
PRP18_HUMAN

NCBI Description

Pre-mRNA splicing occurs in 2 sequential transesterification steps. The protein encoded by this gene is found to be essential for the catalytic step II in pre-mRNA splicing process. It is found in the spliceosome, and contains seven WD repeats, which function in protein-protein interactions. This protein has a sequence similarity to the yeast splicing factor Prp18. [provided by RefSeq, Jul 2008]

Uniprot Description

PRPF18: Participates in the second step of pre-mRNA splicing. Belongs to the PRP18 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Spliceosome; RNA splicing

Chromosomal Location of Human Ortholog: 10p13

Cellular Component: spliceosome; nuclear speck; nucleus

Molecular Function: potassium channel inhibitor activity

Biological Process: RNA splicing; mRNA processing

Research Articles on PRPF18

Similar Products

Product Notes

The PRPF18 prpf18 (Catalog #AAA3215789) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PRPF18 Antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PRPF18 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PRPF18 prpf18 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NKGLRNDLKA ALDKIDQQYL NEIVGGQEPG EEDTQNDLKV HEENTTIEEL. It is sometimes possible for the material contained within the vial of "PRPF18, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.