Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-RAD9A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: MCF7 cell lysateRAD9A is supported by BioGPS gene expression data to be expressed in MCF7)

Rabbit anti-Horse, Human RAD9A Polyclonal Antibody | anti-RAD9A antibody

RAD9A antibody - C-terminal region

Gene Names
RAD9A; RAD9
Reactivity
Horse, Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
RAD9A; Polyclonal Antibody; RAD9A antibody - C-terminal region; anti-RAD9A antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Horse, Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SLSPGPQPPKSPGPHSEEEDEAEPSTVPGTPPPKKFRSLFFGSILAPVRS
Sequence Length
391
Applicable Applications for anti-RAD9A antibody
Western Blot (WB)
Homology
Horse: 84%; Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human RAD9A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-RAD9A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: MCF7 cell lysateRAD9A is supported by BioGPS gene expression data to be expressed in MCF7)

Western Blot (WB) (WB Suggested Anti-RAD9A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: MCF7 cell lysateRAD9A is supported by BioGPS gene expression data to be expressed in MCF7)
Related Product Information for anti-RAD9A antibody
This is a rabbit polyclonal antibody against RAD9A. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: RAD9A is highly similar to Schizosaccharomyces pombe rad9, a cell cycle checkpoint protein required for cell cycle arrest and DNA damage repair in response to DNA damage. This protein is found to possess 3' to 5' exonuclease activity, which may contribute to its role in sensing and repairing DNA damage. It forms a checkpoint protein complex with RAD1 and HUS1. This complex is recruited by checkpoint protein RAD17 to the sites of DNA damage, which is thought to be important for triggering the checkpoint-signaling cascade. This gene product is highly similar to Schizosaccharomyces pombe rad9, a cell cycle checkpoint protein required for cell cycle arrest and DNA damage repair in response to DNA damage. This protein is found to possess 3' to 5' exonuclease activity, which may contribute to its role in sensing and repairing DNA damage. It forms a checkpoint protein complex with RAD1 and HUS1. This complex is recruited by checkpoint protein RAD17 to the sites of DNA damage, which is thought to be important for triggering the checkpoint-signaling cascade. Use of alternative polyA sites has been noted for this gene. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. ADPGK (EC 2.7.1.147) catalyzes the ADP-dependent phosphorylation of glucose to glucose-6-phosphate and may play a role in glycolysis, possibly during ischemic conditions (Ronimus and Morgan, 2004 [PubMed 14975750]).[supplied by OMIM].

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42kDa
NCBI Official Full Name
cell cycle checkpoint control protein RAD9A isoform 1
NCBI Official Synonym Full Names
RAD9 checkpoint clamp component A
NCBI Official Symbol
RAD9A
NCBI Official Synonym Symbols
RAD9
NCBI Protein Information
cell cycle checkpoint control protein RAD9A
UniProt Protein Name
Cell cycle checkpoint control protein RAD9A
UniProt Gene Name
RAD9A
UniProt Synonym Gene Names
hRAD9
UniProt Entry Name
RAD9A_HUMAN

NCBI Description

This gene product is highly similar to Schizosaccharomyces pombe rad9, a cell cycle checkpoint protein required for cell cycle arrest and DNA damage repair. This protein possesses 3' to 5' exonuclease activity, which may contribute to its role in sensing and repairing DNA damage. It forms a checkpoint protein complex with RAD1 and HUS1. This complex is recruited by checkpoint protein RAD17 to the sites of DNA damage, which is thought to be important for triggering the checkpoint-signaling cascade. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2011]

Uniprot Description

Rad9: a cell cycle checkpoint protein required for cell cycle arrest and DNA damage repair in response to DNA damage. Possesses a 3' to 5' exonuclease activity, which may contribute to its role in sensing and repairing DNA damage. Forms a checkpoint protein complex with RAD1 and HUS1. This complex is recruited by checkpoint protein RAD17 to the sites of DNA damage, which is thought to be important for triggering the checkpoint-signaling cascade. Use of alternative polyA sites has been noted for Rad9.

Protein type: EC 3.1.11.2; DNA replication; Deoxyribonuclease; Apoptosis; Cell cycle regulation

Chromosomal Location of Human Ortholog: 11q13.1-q13.2

Cellular Component: nucleoplasm; cytoplasm; nucleus

Molecular Function: protein binding; enzyme binding; histone deacetylase binding; exodeoxyribonuclease III activity; 3'-5' exonuclease activity; SH3 domain binding; protein kinase binding

Biological Process: intra-S DNA damage checkpoint; DNA damage checkpoint; DNA replication checkpoint; DNA replication; DNA repair; DNA catabolic process, exonucleolytic; response to DNA damage stimulus

Research Articles on RAD9A

Similar Products

Product Notes

The RAD9A rad9a (Catalog #AAA3224379) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RAD9A antibody - C-terminal region reacts with Horse, Human and may cross-react with other species as described in the data sheet. AAA Biotech's RAD9A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RAD9A rad9a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SLSPGPQPPK SPGPHSEEED EAEPSTVPGT PPPKKFRSLF FGSILAPVRS. It is sometimes possible for the material contained within the vial of "RAD9A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.