Mouse anti-Human R3HDM2 Polyclonal Antibody | anti-R3HDM2 antibody

R3HDM2 (R3H Domain-containing Protein 2, KIAA1002)

Cat. Num. AAA6005438

• Gene Names: R3HDM2; PR01365
• Reactivity: Human
• Applications: Western Blot, Immunofluorescence
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: R3HDM2; Polyclonal Antibody; R3HDM2 (R3H Domain-containing Protein 2; KIAA1002); Anti -R3HDM2 (R3H Domain-containing Protein 2; anti-R3HDM2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human R3HDM2.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MRPPVTKASSFSGISILTRGDSIGSSKGGSAGRISRPGMALGAPEVCNQVTSSQSVRGLLPCTAQQQQQQQQQQLPALPPTPQQQPPLNNHMISQADDLSNPFGQMSLSRQGSTEAADPSAALFQTPLISQHPQQTSFIMASTGQPLPTSNYSTSSHAPPTQQVLPPQGYMQPPQQIQVSYYPPGQYPNSNQQYRPLSHPVAYSPQRGQQLPQPSQQPGLQPMMPNQQQAAYQGMIGVQQPQNQGLLSSQRSSMGGQMQGLVVQYTPLPSYQVPVGSDSQNVVQPPFQQPMLVPVSQSVQGGLPAAGVPVYYSMIPPAQQNGTSPSVGFLQPPGSEQYQMPQSPSPCSPPQMPQQYSGVSPSGPGVVVMQLNVPNGPQPPQNPSMVQWSHCKYYSMDQRGQKPGDLYSPDSSPQANTQMSSSPVTSPTQSPAPSPVTSLSSVCTGLSPLPVLTQFPRPGGPAQGDGRYSLLGQPLQYNLSICPPLLHGQSTYTVHQGQSGLKHGNRGKRQALKSASTDLGTADVVLGRVLEVTDLPEGITRTEADKLFTQLAMSGAKIQWLKDAQGLPGGGGGDNSGTAENGRHSDLAALYTIVAVFPSPLAAQNASLRLNNSVSRFKLRMAKKNYDLRILERASSQ

• Applicable Applications for anti-R3HDM2 antibody: Western Blot (WB), Immunofluorescence (IF)
• Application Notes: Suitable for use in Immunofluorescence and Western Blot.; Dilution: Immunofluorescence: 10ug/ml
• Immunogen: Full length human R3HDM2, aa1-637 (NP_055740.2).
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of R3HDM2 expression in transfected 293T cell line by R3HDM2 polyclonal antibody. Lane 1: KIAA1002 transfected lysate (70.07kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of purified antibody to R3HDM2 on HeLa cell. [antibody concentration 10ug/ml])

Related Product Information for anti-R3HDM2 antibody

The R3H motif is characterised by the presence of an invariant arginine residue and a highly conserved histidine residue, which are separated by three residues. The function of the domain is predicted to be binding ssDNA. There are two named isoforms of R3HDM2.

Product Categories/Family for anti-R3HDM2 antibody

Antibodies; Abs to Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 219520596
• NCBI GeneID: 22864
• UniProt Accession #: Q9Y2K5; Q2M1T9; Q3ZCT5
• Molecular Weight: 106,999 Da
• NCBI Official Full Name: R3HDM2 protein
• NCBI Official Synonym Full Names: R3H domain containing 2
• NCBI Official Symbol: R3HDM2
• NCBI Official Synonym Symbols: PR01365
• NCBI Protein Information: R3H domain-containing protein 2
• UniProt Protein Name: R3H domain-containing protein 2
• Protein Family: R3H domain-containing protein
• UniProt Gene Name: R3HDM2
• UniProt Synonym Gene Names: KIAA1002
• UniProt Entry Name: R3HD2_HUMAN

Uniprot Description

R3HDM2: 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Unknown function

Chromosomal Location of Human Ortholog: 12q13.3

Cellular Component: nucleus