Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (PFDN5 polyclonal antibody. Western Blot analysis of PFDN5 expression in human pancreas.)

Mouse anti-Human PFDN5 Polyclonal Antibody | anti-PFDN5 antibody

PFDN5 (MM1, PFD5, Prefoldin Subunit 5, C-Myc-binding Protein Mm-1, Myc Modulator 1, MGC5329, MGC71907)

Gene Names
PFDN5; MM1; MM-1; PFD5
Reactivity
Human
Applications
Western Blot, Immunofluorescence
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
PFDN5; Polyclonal Antibody; PFDN5 (MM1; PFD5; Prefoldin Subunit 5; C-Myc-binding Protein Mm-1; Myc Modulator 1; MGC5329; MGC71907); Anti -PFDN5 (MM1; anti-PFDN5 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human PFDN5.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MAQSINITELNLPQLEMLKNQLDQEVEFLSTSIAQLKVVQTKYVEAKDCLNVLNKSNEGKELLVPLTSSMYVPGKLHDVEHVLIDVGTGYYVEKTAEDAKDFFKRKIDFLTKQMEKIQPALQEKHAMKQAVMEMMSQKIQQLTALGAAQATAKA
Applicable Applications for anti-PFDN5 antibody
Western Blot (WB), Immunofluorescence (IF)
Application Notes
Suitable for use in Immunofluorescence and Western Blot.
Dilution: Immunofluorescence: 10ug/ml
Immunogen
Full length human PFDN5, aa1-154.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(PFDN5 polyclonal antibody. Western Blot analysis of PFDN5 expression in human pancreas.)

Western Blot (WB) (PFDN5 polyclonal antibody. Western Blot analysis of PFDN5 expression in human pancreas.)

Western Blot (WB)

(Western Blot analysis of PFDN5 expression in transfected 293T cell line by PFDN5 polyclonal antibody. Lane 1: PFDN5 transfected lysate (16.94kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of PFDN5 expression in transfected 293T cell line by PFDN5 polyclonal antibody. Lane 1: PFDN5 transfected lysate (16.94kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of purified antibody to PFDN5 on HeLa cell. [antibody concentration 10ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of purified antibody to PFDN5 on HeLa cell. [antibody concentration 10ug/ml].)
Related Product Information for anti-PFDN5 antibody
This gene encodes a member of the prefoldin alpha subunit family. The encoded protein is one of six subunits of prefoldin, a molecular chaperone complex that binds and stabilizes newly synthesized polypeptides, thereby allowing them to fold correctly. The complex, consisting of two alpha and four beta subunits, forms a double beta barrel assembly with six protruding coiled-coils. The encoded protein may also repress the transcriptional activity of the proto-oncogene c-Myc. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq].
Product Categories/Family for anti-PFDN5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
17,328 Da
NCBI Official Full Name
prefoldin subunit 5 isoform gamma
NCBI Official Synonym Full Names
prefoldin subunit 5
NCBI Official Symbol
PFDN5
NCBI Official Synonym Symbols
MM1; MM-1; PFD5
NCBI Protein Information
prefoldin subunit 5; myc modulator-1; c-myc binding protein
UniProt Protein Name
Prefoldin subunit 5
Protein Family
UniProt Gene Name
PFDN5
UniProt Synonym Gene Names
MM1; PFD5
UniProt Entry Name
PFD5_HUMAN

NCBI Description

This gene encodes a member of the prefoldin alpha subunit family. The encoded protein is one of six subunits of prefoldin, a molecular chaperone complex that binds and stabilizes newly synthesized polypeptides, thereby allowing them to fold correctly. The complex, consisting of two alpha and four beta subunits, forms a double beta barrel assembly with six protruding coiled-coils. The encoded protein may also repress the transcriptional activity of the proto-oncogene c-Myc. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jul 2008]

Uniprot Description

PFDN5: Binds specifically to cytosolic chaperonin (c-CPN) and transfers target proteins to it. Binds to nascent polypeptide chain and promotes folding in an environment in which there are many competing pathways for nonnative proteins. Represses the transcriptional activity of MYC. Belongs to the prefoldin subunit alpha family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription, coactivator/corepressor

Chromosomal Location of Human Ortholog: 12q12

Cellular Component: cytoplasm; nucleus; prefoldin complex

Molecular Function: protein binding; unfolded protein binding; transcription corepressor activity

Biological Process: 'de novo' posttranslational protein folding; cellular protein metabolic process; regulation of transcription, DNA-dependent; protein folding; retina development in camera-type eye; negative regulation of transcription, DNA-dependent

Research Articles on PFDN5

Similar Products

Product Notes

The PFDN5 pfdn5 (Catalog #AAA643825) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PFDN5 (MM1, PFD5, Prefoldin Subunit 5, C-Myc-binding Protein Mm-1, Myc Modulator 1, MGC5329, MGC71907) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PFDN5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunofluorescence (IF). Suitable for use in Immunofluorescence and Western Blot. Dilution: Immunofluorescence: 10ug/ml. Researchers should empirically determine the suitability of the PFDN5 pfdn5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAQSINITEL NLPQLEMLKN QLDQEVEFLS TSIAQLKVVQ TKYVEAKDCL NVLNKSNEGK ELLVPLTSSM YVPGKLHDVE HVLIDVGTGY YVEKTAEDAK DFFKRKIDFL TKQMEKIQPA LQEKHAMKQA VMEMMSQKIQ QLTALGAAQA TAKA. It is sometimes possible for the material contained within the vial of "PFDN5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.