Western Blot (WB)
(WB Suggested Anti-PUS1 AntibodyTitration: 1.0 ug/mlPositive Control: Jurkat Whole CellPUS1 is supported by BioGPS gene expression data to be expressed in Jurkat)
Rabbit PUS1 Polyclonal Antibody | anti-PUS1 antibody
PUS1 antibody - N-terminal region
Gene Names
PUS1; MLASA1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PUS1; Polyclonal Antibody; PUS1 antibody - N-terminal region; anti-PUS1 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LVSALVRSGCIPENHGEDMRKMSFQRCARTDKGVSAAGQVVSLKVWLIDD
Sequence Length
423
Applicable Applications for anti-PUS1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Yeast: 100%; Zebrafish: 93%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-PUS1 AntibodyTitration: 1.0 ug/mlPositive Control: Jurkat Whole CellPUS1 is supported by BioGPS gene expression data to be expressed in Jurkat)
Western Blot (WB)
(WB Suggested Anti-PUS1 AntibodyTitration: 1.0 ug/mlPositive Control: Jurkat Whole CellPUS1 is supported by BioGPS gene expression data to be expressed in Jurkat)
Related Product Information for anti-PUS1 antibody
This is a rabbit polyclonal antibody against PUS1. It was validated on Western Blot
Target Description: Pus1 converts specific uridines to PSI in a number of tRNA substrates. Pus1 acts on positions 27/28 in the anticodon stem and also positions 34 and 36 in the anticodon of an intron containing tRNA. Pus1 is involved in regulation of nuclear receptor activi
Target Description: Pus1 converts specific uridines to PSI in a number of tRNA substrates. Pus1 acts on positions 27/28 in the anticodon stem and also positions 34 and 36 in the anticodon of an intron containing tRNA. Pus1 is involved in regulation of nuclear receptor activi
Product Categories/Family for anti-PUS1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
48kDa
NCBI Official Full Name
tRNA pseudouridine synthase A isoform 2
NCBI Official Synonym Full Names
pseudouridine synthase 1
NCBI Official Symbol
PUS1
NCBI Official Synonym Symbols
MLASA1
NCBI Protein Information
tRNA pseudouridine synthase A
Protein Family
NCBI Description
This gene encodes a pseudouridine synthase that converts uridine to pseudouridine once it has been incorporated into an RNA molecule. The encoded enzyme may play an essential role in tRNA function and in stabilizing the secondary and tertiary structure of many RNAs. A mutation in this gene has been linked to mitochondrial myopathy and sideroblastic anemia. Alternate splicing results in multiple transcript variants.[provided by RefSeq, Sep 2009]
Research Articles on PUS1
Similar Products
Product Notes
The PUS1 (Catalog #AAA3215326) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PUS1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's PUS1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PUS1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LVSALVRSGC IPENHGEDMR KMSFQRCART DKGVSAAGQV VSLKVWLIDD. It is sometimes possible for the material contained within the vial of "PUS1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
