Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-EIF3D AntibodyTitration: 1.0 ug/mlPositive Control: HT1080 Whole CellEIF3D is supported by BioGPS gene expression data to be expressed in HT1080)

Rabbit EIF3D Polyclonal Antibody | anti-EIF3D antibody

EIF3D antibody - N-terminal region

Gene Names
EIF3D; EIF3S7; eIF3-p66; eIF3-zeta
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
EIF3D; Polyclonal Antibody; EIF3D antibody - N-terminal region; anti-EIF3D antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KSAKQKERERIRLQKKFQKQFGVRQKWDQKSQKPRDSSVEVRSDWEVKEE
Sequence Length
548
Applicable Applications for anti-EIF3D antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 82%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-EIF3D AntibodyTitration: 1.0 ug/mlPositive Control: HT1080 Whole CellEIF3D is supported by BioGPS gene expression data to be expressed in HT1080)

Western Blot (WB) (WB Suggested Anti-EIF3D AntibodyTitration: 1.0 ug/mlPositive Control: HT1080 Whole CellEIF3D is supported by BioGPS gene expression data to be expressed in HT1080)
Related Product Information for anti-EIF3D antibody
This is a rabbit polyclonal antibody against EIF3D. It was validated on Western Blot

Target Description: Eukaryotic translation initiation factor-3 (eIF3), the largest of the eIFs, is a multiprotein complex composed of at least ten nonidentical subunits. The complex binds to the 40S ribosome and helps maintain the 40S and 60S ribosomal subunits in a dissociated state. It is also thought to play a role in the formation of the 40S initiation complex by interacting with the ternary complex of eIF2/GTP/methionyl-tRNA, and by promoting mRNA binding. The protein encoded by this gene is the major RNA binding subunit of the eIF3 complex.
Product Categories/Family for anti-EIF3D antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
60kDa
NCBI Official Full Name
eukaryotic translation initiation factor 3 subunit D
NCBI Official Synonym Full Names
eukaryotic translation initiation factor 3 subunit D
NCBI Official Symbol
EIF3D
NCBI Official Synonym Symbols
EIF3S7; eIF3-p66; eIF3-zeta
NCBI Protein Information
eukaryotic translation initiation factor 3 subunit D
UniProt Protein Name
Eukaryotic translation initiation factor 3 subunit D
UniProt Gene Name
EIF3D
UniProt Synonym Gene Names
EIF3S7; eIF3d
UniProt Entry Name
EIF3D_HUMAN

NCBI Description

Eukaryotic translation initiation factor-3 (eIF3), the largest of the eIFs, is a multiprotein complex composed of at least ten nonidentical subunits. The complex binds to the 40S ribosome and helps maintain the 40S and 60S ribosomal subunits in a dissociated state. It is also thought to play a role in the formation of the 40S initiation complex by interacting with the ternary complex of eIF2/GTP/methionyl-tRNA, and by promoting mRNA binding. The protein encoded by this gene is the major RNA binding subunit of the eIF3 complex. [provided by RefSeq, Jul 2008]

Uniprot Description

eIF3-zeta: eukaryotic translation initiation factor 3 subunit 7. Binds to the 40S ribosome and promotes the binding of methionyl-tRNAi and mRNA. Associates with the subunit p170 of eIF-3. eIF-3 is composed of at least 12 different subunits.

Protein type: Translation; RNA-binding; Translation initiation

Chromosomal Location of Human Ortholog: 22q13.1

Cellular Component: eukaryotic translation initiation factor 3 complex; membrane; cytosol

Molecular Function: protein binding; translation initiation factor activity

Biological Process: cellular protein metabolic process; translation; translational initiation; gene expression; formation of translation initiation complex; formation of translation preinitiation complex; regulation of translational initiation

Research Articles on EIF3D

Similar Products

Product Notes

The EIF3D eif3d (Catalog #AAA3215603) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The EIF3D antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's EIF3D can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the EIF3D eif3d for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KSAKQKERER IRLQKKFQKQ FGVRQKWDQK SQKPRDSSVE VRSDWEVKEE. It is sometimes possible for the material contained within the vial of "EIF3D, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.