Mouse SMAD2 Monoclonal Antibody | anti-SMAD2 antibody

SMAD2 (SMAD Family Member 2, JV18, JV18-1, MADH2, MADR2, MGC22139, MGC34440, hMAD-2, hSMAD2) (Biotin)

Cat. Num. AAA6170465

• Gene Names: SMAD2; JV18; MADH2; MADR2; JV18-1; hMAD-2; hSMAD2
• Applications: Immunofluorescence, Immunohistochemistry, Western Blot
• Purity: Purified
• Synonyms: SMAD2; Monoclonal Antibody; SMAD2 (SMAD Family Member 2; JV18; JV18-1; MADH2; MADR2; MGC22139; MGC34440; hMAD-2; hSMAD2) (Biotin); SMAD Family Member 2; hSMAD2; anti-SMAD2 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 3G9
• Specificity: Recognizes SMAD2.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
• Sequence Length: 467

• Applicable Applications for anti-SMAD2 antibody: Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: SMAD2 (AAH25699, 181aa-280aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: PRHTEILTELPPLDDYTHSIPENTNFPAGIEPQSNYIPETPPPGYISEDGETSDQQLNQSMDTGSPAELSPTTLSPVNHSLDLQPVTYSEPAFWCSIAYY
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Immunoperoxidase of monoclonal antibody to SMAD2 on formalin-fixed paraffin-embedded human testis. [antibody concentration 5 ug/ml])

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to SMAD2 on formalin-fixed paraffin-embedded human testis. [antibody concentration 5 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to SMAD2 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to SMAD2 on HeLa cell. [antibody concentration 10 ug/ml])

Western Blot (WB)

(SMAD2 monoclonal antibody (M05), clone 3G9 Western Blot analysis of SMAD2 expression in Hela S3 NE.)

Testing Data

(Detection limit for recombinant GST tagged SMAD2 is approximately 0.1ng/ml as a capture antibody.)

Related Product Information for anti-SMAD2 antibody

The protein encoded by this gene belongs to the SMAD, a family of proteins similar to the gene products of the Drosophila gene 'mothers against decapentaplegic' (Mad) and the C. elegans gene Sma. SMAD proteins are signal transducers and transcriptional modulators that mediate multiple signaling pathways. This protein mediates the signal of the transforming growth factor (TGF)-beta, and thus regulates multiple cellular processes, such as cell proliferation, apoptosis, and differentiation. This protein is recruited to the TGF-beta receptors through its interaction with the SMAD anchor for receptor activation (SARA) protein. In response to TGF-beta signal, this protein is phosphorylated by the TGF-beta receptors. The phosphorylation induces the dissociation of this protein with SARA and the association with the family member SMAD4. The association with SMAD4 is important for the translocation of this protein into the nucleus, where it binds to target promoters and forms a transcription repressor complex with other cofactors. This protein can also be phosphorylated by activin type 1 receptor kinase, and mediates the signal from the activin. Alternatively spliced transcript variants encoding the same protein have been observed. [provided by RefSeq]

Product Categories/Family for anti-SMAD2 antibody

Antibodies; Smad Proteins

References

1. Altered expression of p120catenin predicts poor outcome in invasive breast cancer. Talvinen K, Tuikkala J, Nykanen M, Nieminen A, Anttinen J, Nevalainen OS, Hurme S, Kuopio T, Kronqvist P.J Cancer Res Clin Oncol. 2010 Feb 12.

NCBI and Uniprot Product Information

• NCBI GI #: 19344008
• NCBI GeneID: 4087
• NCBI Official Full Name: SMAD family member 2
• NCBI Official Synonym Full Names: SMAD family member 2
• NCBI Official Symbol: SMAD2
• NCBI Official Synonym Symbols: JV18; MADH2; MADR2; JV18-1; hMAD-2; hSMAD2
• NCBI Protein Information: mothers against decapentaplegic homolog 2
• Protein Family: Mothers against decapentaplegic

NCBI Description

The protein encoded by this gene belongs to the SMAD, a family of proteins similar to the gene products of the Drosophila gene 'mothers against decapentaplegic' (Mad) and the C. elegans gene Sma. SMAD proteins are signal transducers and transcriptional modulators that mediate multiple signaling pathways. This protein mediates the signal of the transforming growth factor (TGF)-beta, and thus regulates multiple cellular processes, such as cell proliferation, apoptosis, and differentiation. This protein is recruited to the TGF-beta receptors through its interaction with the SMAD anchor for receptor activation (SARA) protein. In response to TGF-beta signal, this protein is phosphorylated by the TGF-beta receptors. The phosphorylation induces the dissociation of this protein with SARA and the association with the family member SMAD4. The association with SMAD4 is important for the translocation of this protein into the nucleus, where it binds to target promoters and forms a transcription repressor complex with other cofactors. This protein can also be phosphorylated by activin type 1 receptor kinase, and mediates the signal from the activin. Alternatively spliced transcript variants have been observed for this gene. [provided by RefSeq, May 2012]