Western Blot (WB)
(WB Suggested Anti-PTH2R AntibodyTitration: 1.0 ug/mlPositive Control: OVCAR-3 Whole CellPTH2R is supported by BioGPS gene expression data to be expressed in OVCAR3)
Rabbit PTH2R Polyclonal Antibody | anti-PTH2R antibody
PTH2R Antibody - C-terminal region
Reactivity
Cow, Guinea Pig, Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PTH2R; Polyclonal Antibody; PTH2R Antibody - C-terminal region; anti-PTH2R antibody
Host
Rabbit
Reactivity
Cow, Guinea Pig, Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NSEQDCLPHSFHEETKEDSGRQGDDILMEKPSRPMESNPDTEGCQGETED
Sequence Length
550
Applicable Applications for anti-PTH2R antibody
Western Blot (WB)
Homology
Cow: 79%; Guinea Pig: 86%; Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human PTH2R
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-PTH2R AntibodyTitration: 1.0 ug/mlPositive Control: OVCAR-3 Whole CellPTH2R is supported by BioGPS gene expression data to be expressed in OVCAR3)
Western Blot (WB)
(WB Suggested Anti-PTH2R AntibodyTitration: 1.0 ug/mlPositive Control: OVCAR-3 Whole CellPTH2R is supported by BioGPS gene expression data to be expressed in OVCAR3)
Related Product Information for anti-PTH2R antibody
This is a rabbit polyclonal antibody against PTH2R. It was validated on Western Blot
Target Description: The protein encoded by this gene is a member of the G-protein coupled receptor family 2. This protein is a receptor for parathyroid hormone (PTH). This receptor is more selective in ligand recognition and has a more specific tissue distribution compared to parathyroid hormone receptor 1 (PTHR1). It is activated only by PTH and not by parathyroid hormone-like hormone (PTHLH) and is particularly abundant in brain and pancreas.
Target Description: The protein encoded by this gene is a member of the G-protein coupled receptor family 2. This protein is a receptor for parathyroid hormone (PTH). This receptor is more selective in ligand recognition and has a more specific tissue distribution compared to parathyroid hormone receptor 1 (PTHR1). It is activated only by PTH and not by parathyroid hormone-like hormone (PTHLH) and is particularly abundant in brain and pancreas.
Product Categories/Family for anti-PTH2R antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
60kDa
NCBI Official Full Name
parathyroid hormone 2 receptor isoform 1
UniProt Protein Name
Parathyroid hormone 2 receptor
Protein Family
UniProt Gene Name
PTH2R
UniProt Synonym Gene Names
PTHR2; PTH2 receptor
UniProt Entry Name
PTH2R_HUMAN
Uniprot Description
PTH2R: This is a specific receptor for parathyroid hormone. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. PTH2R may be responsible for PTH effects in a number of physiological systems. It may play a significant role in pancreatic function. PTH2R presence in neurons indicates that it may function as a neurotransmitter receptor. Belongs to the G-protein coupled receptor 2 family.
Protein type: Membrane protein, multi-pass; Receptor, GPCR; GPCR, family 2; Membrane protein, integral
Chromosomal Location of Human Ortholog: 2q33
Cellular Component: integral to plasma membrane; plasma membrane
Molecular Function: parathyroid hormone receptor activity
Biological Process: G-protein coupled receptor protein signaling pathway
Similar Products
Product Notes
The PTH2R pth2r (Catalog #AAA3216598) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PTH2R Antibody - C-terminal region reacts with Cow, Guinea Pig, Human and may cross-react with other species as described in the data sheet. AAA Biotech's PTH2R can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PTH2R pth2r for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NSEQDCLPHS FHEETKEDSG RQGDDILMEK PSRPMESNPD TEGCQGETED. It is sometimes possible for the material contained within the vial of "PTH2R, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
