Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-NPB AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Brain)

Rabbit NPB Polyclonal Antibody | anti-NPB antibody

NPB Antibody - C-terminal region

Gene Names
NPB; L7; PPL7; PPNPB
Reactivity
Cow, Dog, Human, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
NPB; Polyclonal Antibody; NPB Antibody - C-terminal region; anti-NPB antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Human, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PPGGAGASPELQLHPRLRSLAVCVQDVAPNLQRCERLPDGRGTYQCKANV
Sequence Length
125
Applicable Applications for anti-NPB antibody
Western Blot (WB)
Homology
Cow: 79%; Dog: 79%; Human: 100%; Rat: 90%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of NPB
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-NPB AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Brain)

Western Blot (WB) (WB Suggested Anti-NPB AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Brain)
Related Product Information for anti-NPB antibody
This is a rabbit polyclonal antibody against NPB. It was validated on Western Blot

Target Description: Neuropeptide B (NPB) is an endogenous peptide ligand for G protein-coupled receptor-7.
Product Categories/Family for anti-NPB antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
14kDa
NCBI Official Full Name
neuropeptide B preproprotein
NCBI Official Synonym Full Names
neuropeptide B
NCBI Official Symbol
NPB
NCBI Official Synonym Symbols
L7; PPL7; PPNPB
NCBI Protein Information
neuropeptide B
UniProt Protein Name
Neuropeptide B
Protein Family
UniProt Gene Name
NPB
UniProt Synonym Gene Names
PPL7; PPNPB; hPPL7; NPB23; hL7; NPB29; hL7C
UniProt Entry Name
NPB_HUMAN

NCBI Description

This gene encodes a member of the neuropeptide B/W family of proteins and preproprotein that is proteolytically processed to generate multiple protein products. The encoded products include neuropeptide B-23 and a C-terminally extended form, neuropeptide B-29, which are characterized by an N-terminal brominated tryptophan amino acid. Both of the encoded peptides bind with higher affinity to neuropeptide B/W (NPB/W) receptor 1 compared to the related NPB/W receptor 2. These peptides may regulate feeding, pain perception, and stress in rodents. [provided by RefSeq, Jul 2015]

Uniprot Description

NPB: May be involved in the regulation of feeding, neuroendocrine system, memory, learning and in the afferent pain pathway. Belongs to the neuropeptide B/W family.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 17q25.3

Cellular Component: extracellular region

Molecular Function: protein binding; G-protein-coupled receptor binding

Biological Process: G-protein coupled receptor protein signaling pathway; neuropeptide signaling pathway

Research Articles on NPB

Similar Products

Product Notes

The NPB npb (Catalog #AAA3215992) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NPB Antibody - C-terminal region reacts with Cow, Dog, Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's NPB can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NPB npb for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PPGGAGASPE LQLHPRLRSL AVCVQDVAPN LQRCERLPDG RGTYQCKANV. It is sometimes possible for the material contained within the vial of "NPB, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.