Rabbit anti-Human PSPH Polyclonal Antibody | anti-PSPH antibody

PSPH (Phosphoserine Phosphatase, L-3-phosphoserine Phosphatase, O-phosphoserine Phosphohydrolase) (FITC)

Cat. Num. AAA6391234

• Gene Names: PSPH; PSP; PSPHD
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: PSPH; Polyclonal Antibody; PSPH (Phosphoserine Phosphatase; L-3-phosphoserine Phosphatase; O-phosphoserine Phosphohydrolase) (FITC); anti-PSPH antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human PSPH.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein Isothiocyanate (FITC).

• Applicable Applications for anti-PSPH antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human PSPH, aa1-225 (NP_004568.2).
• Immunogen Sequence: MVSHSELRKLFYSADAVCFDVDSTVIREEGIDELAKICGVEDAVSEMTRRAMGGAVPFKAALTERLALIQPSREQVQRLIAEQPPHLTPGIRELVSRLQERNVQVFLISGGFRSIVEHVASKLNIPATNVFANRLKFYFNGEYAGFDETQPTAESGGKGKVIKLLKEKFHFKKIIMIGDGATDMEACPPADAFIGFGGNVIRQQVKDNAKWYITDFVELLGELEE
• Conjugate: FITC
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of PSPH expression in transfected 293T cell line by PSPH polyclonal antibody. Lane 1: PSPH transfected lysate (25kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-PSPH antibody

The protein encoded by this gene belongs to a subfamily of the phosphotransferases. This encoded enzyme is responsible for the third and last step in L-serine formation. It catalyzes magnesium-dependent hydrolysis of L-phosphoserine and is also involved in an exchange reaction between L-serine and L-phosphoserine. Deficiency of this protein is thought to be linked to Williams syndrome.

Product Categories/Family for anti-PSPH antibody

Antibodies; Enzymes; Phosphatase

NCBI and Uniprot Product Information

• NCBI GI #: 46249388
• NCBI GeneID: 5723
• NCBI Accession #: NP_004568.2
• NCBI GenBank Nucleotide #: NM_004577.3
• Molecular Weight: 25,008 Da
• NCBI Official Full Name: phosphoserine phosphatase
• NCBI Official Synonym Full Names: phosphoserine phosphatase
• NCBI Official Symbol: PSPH
• NCBI Official Synonym Symbols: PSP; PSPHD
• NCBI Protein Information: phosphoserine phosphatase; L-3-phosphoserine phosphatase; O-phosphoserine phosphohydrolase; PSPase

NCBI Description

The protein encoded by this gene belongs to a subfamily of the phosphotransferases. This encoded enzyme is responsible for the third and last step in L-serine formation. It catalyzes magnesium-dependent hydrolysis of L-phosphoserine and is also involved in an exchange reaction between L-serine and L-phosphoserine. Deficiency of this protein is thought to be linked to Williams syndrome. [provided by RefSeq, Jul 2008]