Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: PRDM12Sample Tissue: Human Hela Whole CellAntibody Dilution: 1ug/ml)

Rabbit PRDM12 Polyclonal Antibody | anti-PRDM12 antibody

PRDM12 antibody - N-terminal region

Gene Names
PRDM12; PFM9; HSAN8
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PRDM12; Polyclonal Antibody; PRDM12 antibody - N-terminal region; anti-PRDM12 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SFLYGRWRNVLGEQLFEDKSHHASPKTAFTAEVLAQSFSGEVQKLSSLVL
Sequence Length
367
Applicable Applications for anti-PRDM12 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 91%; Guinea Pig: 92%; Human: 100%; Mouse: 92%; Pig: 100%; Rat: 92%; Zebrafish: 83%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human PRDM12
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: PRDM12Sample Tissue: Human Hela Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: PRDM12Sample Tissue: Human Hela Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB)

(WB Suggested Anti-PRDM12 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Thymus)

Western Blot (WB) (WB Suggested Anti-PRDM12 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Thymus)
Related Product Information for anti-PRDM12 antibody
This is a rabbit polyclonal antibody against PRDM12. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: PRDM12 belongs to PR-domain family which are involved in human cancers in an unusual yin-yang fashion. Two products are normally produced from a PR-domain family member which differ by the presence or absence of the PR domain; the PR-plus product is disrupted or underexpressed whereas the PR-minus product is present or overexpressed in cancer cells. This imbalance in the amount of the two products, a result of either genetic or epigenetic events, appears to be an important cause of malignancy. PRDM12 may have a potential role in the pathogenesis of chronic myeloid leukaemia with derivative chromosome 9 deletion.
Product Categories/Family for anti-PRDM12 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40kDa
NCBI Official Full Name
PR domain zinc finger protein 12
NCBI Official Synonym Full Names
PR/SET domain 12
NCBI Official Symbol
PRDM12
NCBI Official Synonym Symbols
PFM9; HSAN8
NCBI Protein Information
PR domain zinc finger protein 12
UniProt Protein Name
PR domain zinc finger protein 12
UniProt Gene Name
PRDM12
UniProt Synonym Gene Names
PFM9
UniProt Entry Name
PRD12_HUMAN

NCBI Description

This gene encodes a transcriptional regulator of sensory neuronal specification that plays a critical role in pain perception. The encoded protein contains an N-terminal PRDI-BF1 and RIZ homology (PR) domain, a SET domain, and three C-terminal C2H2 zinc finger DNA-binding domains. Naturally occurring mutations in this gene are associated with congenital insensitivity to pain (CIP), and hereditary sensory and autonomic neuropathies (HSAN's) affecting peripheral sensory and autonomic neurons. Deregulation of this gene is associated with solid cancers and hematological malignancies including chronic myeloid leukaemia. [provided by RefSeq, Mar 2017]

Uniprot Description

PRDM12: May be involved in transcriptional regulation.

Protein type: Methyltransferase, protein lysine, predicted; C2H2-type zinc finger protein

Chromosomal Location of Human Ortholog: 9q34.12

Cellular Component: nucleus

Molecular Function: methyltransferase activity; DNA binding; metal ion binding

Biological Process: methylation; neurogenesis; regulation of transcription, DNA-dependent; transcription, DNA-dependent

Disease: Neuropathy, Hereditary Sensory And Autonomic, Type Viii

Research Articles on PRDM12

Similar Products

Product Notes

The PRDM12 prdm12 (Catalog #AAA3201391) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PRDM12 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's PRDM12 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PRDM12 prdm12 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SFLYGRWRNV LGEQLFEDKS HHASPKTAFT AEVLAQSFSG EVQKLSSLVL. It is sometimes possible for the material contained within the vial of "PRDM12, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.