Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: Bapx1Sample Type: JurkatLane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 0.5ug/mLPeptide Concentration: 1.0ug/mLLysate Quantity: 25ug/laneGel Concentration: 12%)

Rabbit Bapx1 Polyclonal Antibody | anti-NKX3-2 antibody

Bapx1 antibody - N-terminal region

Gene Names
Nkx3-2; Bapx1; NKX3.2; Nkx-3.2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Bapx1; Polyclonal Antibody; Bapx1 antibody - N-terminal region; anti-NKX3-2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MAVRGSGTLTPFSIQAILNKKEERGGLATPEGRPAPGGTEVAVTAAPAVC
Sequence Length
333
Applicable Applications for anti-NKX3-2 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 83%; Human: 93%; Mouse: 100%; Rabbit: 100%; Rat: 83%; Zebrafish: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of mouse Bapx1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: Bapx1Sample Type: JurkatLane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 0.5ug/mLPeptide Concentration: 1.0ug/mLLysate Quantity: 25ug/laneGel Concentration: 12%)

Western Blot (WB) (Host: RabbitTarget Name: Bapx1Sample Type: JurkatLane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 0.5ug/mLPeptide Concentration: 1.0ug/mLLysate Quantity: 25ug/laneGel Concentration: 12%)

Western Blot (WB)

(WB Suggested Anti-Bapx1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysate)

Western Blot (WB) (WB Suggested Anti-Bapx1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysate)
Related Product Information for anti-NKX3-2 antibody
This is a rabbit polyclonal antibody against Bapx1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Bapx1 acts as a negative regulator of chondrocyte maturation. The constitutive RelA activation mediated by Bapx1 controls chondrocyte viability.
Product Categories/Family for anti-NKX3-2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37kDa
NCBI Official Full Name
homeobox protein Nkx-3.2
NCBI Official Synonym Full Names
NK3 homeobox 2
NCBI Official Symbol
Nkx3-2
NCBI Official Synonym Symbols
Bapx1; NKX3.2; Nkx-3.2
NCBI Protein Information
homeobox protein Nkx-3.2
UniProt Protein Name
Homeobox protein Nkx-3.2
Protein Family
UniProt Gene Name
Nkx3-2
UniProt Synonym Gene Names
Bapx1; Nkx-3.2; Nkx3b
UniProt Entry Name
NKX32_MOUSE

Research Articles on NKX3-2

Similar Products

Product Notes

The NKX3-2 nkx3-2 (Catalog #AAA3203320) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Bapx1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's Bapx1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NKX3-2 nkx3-2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MAVRGSGTLT PFSIQAILNK KEERGGLATP EGRPAPGGTE VAVTAAPAVC. It is sometimes possible for the material contained within the vial of "Bapx1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.