Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-CNOT7 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Placenta)

Rabbit CNOT7 Polyclonal Antibody | anti-CNOT7 antibody

CNOT7 antibody - middle region

Gene Names
CNOT7; CAF1; CAF-1; Caf1a; hCAF-1
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CNOT7; Polyclonal Antibody; CNOT7 antibody - middle region; anti-CNOT7 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LDFFEILRLFFPVIYDVKYLMKSCKNLKGGLQEVAEQLELERIGPQHQAG
Sequence Length
285
Applicable Applications for anti-CNOT7 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 83%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human CNOT7
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-CNOT7 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Placenta)

Western Blot (WB) (WB Suggested Anti-CNOT7 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Placenta)
Related Product Information for anti-CNOT7 antibody
This is a rabbit polyclonal antibody against CNOT7. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: CNOT7 binds to an anti-proliferative protein, B-cell translocation protein 1, which negatively regulates cell proliferation. Binding of the two proteins, which is driven by phosphorylation of the anti-proliferative protein, causes signaling events in cell division that lead to changes in cell proliferation associated with cell-cell contact. The protein has both mouse and yeast orthologs.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33kDa
NCBI Official Full Name
CCR4-NOT transcription complex subunit 7 isoform 1
NCBI Official Synonym Full Names
CCR4-NOT transcription complex subunit 7
NCBI Official Symbol
CNOT7
NCBI Official Synonym Symbols
CAF1; CAF-1; Caf1a; hCAF-1
NCBI Protein Information
CCR4-NOT transcription complex subunit 7
UniProt Protein Name
CCR4-NOT transcription complex subunit 7
UniProt Gene Name
CNOT7
UniProt Synonym Gene Names
CAF1; CAF-1
UniProt Entry Name
CNOT7_HUMAN

NCBI Description

The protein encoded by this gene binds to an anti-proliferative protein, B-cell translocation protein 1, which negatively regulates cell proliferation. Binding of the two proteins, which is driven by phosphorylation of the anti-proliferative protein, causes signaling events in cell division that lead to changes in cell proliferation associated with cell-cell contact. The encoded protein downregulates the innate immune response and therefore provides a therapeutic target for enhancing its antimicrobial activity against foreign agents. Alternative splicing of this gene results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 1 and X. [provided by RefSeq, Apr 2016]

Uniprot Description

CNOT7: Ubiquitous transcription factor required for a diverse set of processes. It is a component of the CCR4 complex involved in the control of gene expression. Belongs to the CAF1 family.

Protein type: EC 3.1.13.4; Transcription, coactivator/corepressor

Chromosomal Location of Human Ortholog: 8p22-p21.3

Cellular Component: membrane; cytosol; nucleus; CCR4-NOT complex

Molecular Function: signal transducer activity; protein binding; 3'-5'-exoribonuclease activity; poly(A)-specific ribonuclease activity; exoribonuclease activity; RNA binding; metal ion binding; transcription factor activity

Biological Process: deadenylation-dependent decapping; transcription, DNA-dependent; signal transduction; miRNA-mediated gene silencing; regulation of translation; negative regulation of cell proliferation; poly(A) tail shortening; positive regulation of cell proliferation; carbohydrate metabolic process; RNA-mediated gene silencing; positive regulation of transcription from RNA polymerase II promoter; gene expression; cytoplasmic mRNA processing body assembly; mRNA catabolic process, deadenylation-dependent decay

Research Articles on CNOT7

Similar Products

Product Notes

The CNOT7 cnot7 (Catalog #AAA3201044) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CNOT7 antibody - middle region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's CNOT7 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CNOT7 cnot7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LDFFEILRLF FPVIYDVKYL MKSCKNLKGG LQEVAEQLEL ERIGPQHQAG. It is sometimes possible for the material contained within the vial of "CNOT7, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.