Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: NOP56Sample Type: Human Fetal MuscleAntibody Dilution: 1.0ug/ml)

Rabbit PAX7 Polyclonal Antibody | anti-PAX7 antibody

PAX7 antibody - middle region

Gene Names
PAX7; HUP1; RMS2; PAX7B
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PAX7; Polyclonal Antibody; PAX7 antibody - middle region; anti-PAX7 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KPGDSLPTSQAYCPPTYSTTGYSVDPVAGYQYGQYGQSECLVPWASPVPI
Sequence Length
520
Applicable Applications for anti-PAX7 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human PAX7
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: NOP56Sample Type: Human Fetal MuscleAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: NOP56Sample Type: Human Fetal MuscleAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: SERPINA3Sample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: SERPINA3Sample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(WB Suggested Anti-PAX7 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: HT1080 cell lysate)

Western Blot (WB) (WB Suggested Anti-PAX7 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: HT1080 cell lysate)
Related Product Information for anti-PAX7 antibody
This is a rabbit polyclonal antibody against PAX7. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: PAX7 is a member of the paired box (PAX) family of transcription factors. Members of this gene family typically contain a paired box domain, an octapeptide, and a paired-type homeodomain. These genes play critical roles during fetal development and cancer growth. The specific function of the paired box gene 7 is unknown but speculated to involve tumor suppression since fusion of this gene with a forkhead domain family member has been associated with alveolar rhabdomyosarcoma. Alternative splicing in this gene has produced two known products but the biological significance of the variants is unknown. This gene is a member of the paired box (PAX) family of transcription factors. Members of this gene family typically contain a paired box domain, an octapeptide, and a paired-type homeodomain. These genes play critical roles during fetal development and cancer growth. The specific function of the paired box 7 gene is unknown but speculated to involve tumor suppression since fusion of this gene with a forkhead domain family member has been associated with alveolar rhabdomyosarcoma. Alternative splicing in this gene has produced two known products but the biological significance of the variants is unknown.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
57kDa
NCBI Official Full Name
paired box protein Pax-7 isoform 3
NCBI Official Synonym Full Names
paired box 7
NCBI Official Symbol
PAX7
NCBI Official Synonym Symbols
HUP1; RMS2; PAX7B
NCBI Protein Information
paired box protein Pax-7
UniProt Protein Name
Paired box protein Pax-7
Protein Family
UniProt Gene Name
PAX7
UniProt Synonym Gene Names
HUP1

NCBI Description

This gene is a member of the paired box (PAX) family of transcription factors. Members of this gene family typically contain a paired box domain, an octapeptide, and a paired-type homeodomain. These genes play critical roles during fetal development and cancer growth. The specific function of the paired box 7 gene is unknown but speculated to involve tumor suppression since fusion of this gene with a forkhead domain family member has been associated with alveolar rhabdomyosarcoma. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2008]

Uniprot Description

Transcription factor playing a role in myogenesis through regulation of muscle precursor cells proliferation.

Research Articles on PAX7

Similar Products

Product Notes

The PAX7 pax7 (Catalog #AAA3200738) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PAX7 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's PAX7 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PAX7 pax7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KPGDSLPTSQ AYCPPTYSTT GYSVDPVAGY QYGQYGQSEC LVPWASPVPI. It is sometimes possible for the material contained within the vial of "PAX7, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.