Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: PPP1CASample Tissue: Human HCT116 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human PPP1CA Polyclonal Antibody | anti-PPP1CA antibody

PPP1CA Antibody - C-terminal region

Gene Names
PPP1CA; PP1A; PP-1A; PPP1A; PP1alpha
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
PPP1CA; Polyclonal Antibody; PPP1CA Antibody - C-terminal region; anti-PPP1CA antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PNYCGEFDNAGAMMSVDETLMCSFQILKPADKNKGKYGQFSGLNPGGRPI
Sequence Length
341
Applicable Applications for anti-PPP1CA antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human PPP1CA
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: PPP1CASample Tissue: Human HCT116 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: PPP1CASample Tissue: Human HCT116 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-PPP1CA antibody
The protein encoded by this gene is one of the three catalytic subunits of protein phosphatase 1 (PP1). PP1 is a serine/threonine specific protein phosphatase known to be involved in the regulation of a variety of cellular processes, such as cell division, glycogen metabolism, muscle contractility, protein synthesis, and HIV-1 viral transcription. Increased PP1 activity has been observed in the end stage of heart failure. Studies in both human and mice suggest that PP1 is an important regulator of cardiac function. Mouse studies also suggest that PP1 functions as a suppressor of learning and memory. Three alternatively spliced transcript variants encoding different isoforms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37 kDa
NCBI Official Full Name
serine/threonine-protein phosphatase PP1-alpha catalytic subunit isoform 3
NCBI Official Synonym Full Names
protein phosphatase 1 catalytic subunit alpha
NCBI Official Symbol
PPP1CA
NCBI Official Synonym Symbols
PP1A; PP-1A; PPP1A; PP1alpha
NCBI Protein Information
serine/threonine-protein phosphatase PP1-alpha catalytic subunit
UniProt Protein Name
Serine/threonine-protein phosphatase PP1-alpha catalytic subunit
UniProt Gene Name
PPP1CA
UniProt Synonym Gene Names
PPP1A; PP-1A
UniProt Entry Name
PP1A_HUMAN

NCBI Description

The protein encoded by this gene is one of the three catalytic subunits of protein phosphatase 1 (PP1). PP1 is a serine/threonine specific protein phosphatase known to be involved in the regulation of a variety of cellular processes, such as cell division, glycogen metabolism, muscle contractility, protein synthesis, and HIV-1 viral transcription. Increased PP1 activity has been observed in the end stage of heart failure. Studies in both human and mice suggest that PP1 is an important regulator of cardiac function. Mouse studies also suggest that PP1 functions as a suppressor of learning and memory. Three alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

PPP1CA: is a catalytic subunit of protein phosphatase 1 (PP1), aubiquitous cytosolic serine-threonine phosphatase. Composed of a catalytic subunit (PPP1CA, PPP1CB or PPP1CC) which is folded into its native form by inhibitor 2 and glycogen synthetase kinase 3, and then complexed to one or several targeting (or regulatory) subunits: PPP1R12A and PPP1R12B mediate binding to myosin; PPP1R3A, PPP1R3B, PPP1R3C and PPP1R3D mediate binding to glycogen; and PPP1R15A and PPP1R15B mediate binding to EIF2S1. PP1 is essential for cell division, plays critical roles in many cellular processes including glycogen metabolism, muscle contractility and protein synthesis, and is involved in the regulation of ionic conductances and long-term synaptic plasticity. Inhibits the synthesis of proteins involved in synaptic plasticity. Binds to the transcription factor cyclic AMP-dependent response element binding (CREB) and dephosphorylates it. May regulate chromatin condensation through regulation of histone H3 phosphorylation. Differentially expressed in gastric cancer. May participate in the neurodegenerative progress in Alzheimer's disease. Down-regulated in lung squamous cell carcinoma.

Protein type: EC 3.1.3.16; Protein phosphatase, Ser/Thr (non-receptor); Nucleolus

Chromosomal Location of Human Ortholog: 11q13

Cellular Component: nucleoplasm; glycogen granule; cytoplasm; nucleolus; plasma membrane; dendritic spine; perikaryon; protein phosphatase type 1 complex; nucleus; cytosol

Molecular Function: ribonucleoprotein binding; protein binding; metal ion binding; phosphoric monoester hydrolase activity; protein serine/threonine phosphatase activity

Biological Process: glycogen metabolic process; regulation of glycogen catabolic process; branching morphogenesis of a tube; cell division; transforming growth factor beta receptor signaling pathway; triacylglycerol catabolic process; regulation of glycogen biosynthetic process; circadian regulation of gene expression; cell cycle; regulation of circadian rhythm; protein amino acid dephosphorylation; negative regulation of transforming growth factor beta receptor signaling pathway; entrainment of circadian clock by photoperiod; lung development

Research Articles on PPP1CA

Similar Products

Product Notes

The PPP1CA ppp1ca (Catalog #AAA3223181) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PPP1CA Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PPP1CA can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PPP1CA ppp1ca for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PNYCGEFDNA GAMMSVDETL MCSFQILKPA DKNKGKYGQF SGLNPGGRPI. It is sometimes possible for the material contained within the vial of "PPP1CA, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.