Bone morphogenetic protein receptor type-1A Recombinant Protein | BMPR1A recombinant protein

Recombinant Human Bone morphogenetic protein receptor type-1A

Cat. Num. AAA953450

• Gene Names: BMPR1A; ALK3; SKR5; CD292; ACVRLK3; 10q23del
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Bone morphogenetic protein receptor type-1A; Recombinant Human Bone morphogenetic protein receptor type-1A; Activin receptor-like kinase 3; ALK-3Serine/threonine-protein kinase receptor R5; SKR5; CD292; BMPR1A recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 177-532aa; Cytoplasmic Domain
• Sequence: KHYCKSISSRRRYNRDLEQDEAFIPVGESLKDLIDQSQSSGSGSGLPLLVQRTIAKQIQMVRQVGKGRYGEVWMGKWRGEKVAVKVFFTTEEASWFRETEIYQTVLMRHENILGFIAADIKGTGSWTQLYLITDYHENGSLYDFLKCATLDTRALLKLAYSAACGLCHLHTEIYGTQGKPAIAHRDLKSKNILIKKNGSCCIADLGLAVKFNSDTNEVDVPLNTRVGTKRYMAPEVLDESLNKNHFQPYIMADIYSFGLIIWEMARRCITGGIVEEYQLPYYNMVPSDPSYEDMREVVCVKRLRPIVSNRWNSDECLRAVLKLMSECWAHNPASRLTALRIKKTLAKMVESQDVKI
• Sequence Length: 532

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for BMPR1A recombinant protein

On ligand binding, forms a receptor complex consisting of two type II and two type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators. Receptor for BMP-2 and BMP-4. Positively regulates chondrocyte differentiation through GDF5 interaction.

Product Categories/Family for BMPR1A recombinant protein

Cardiovascular

References

Activin receptor-like kinases a novel subclass of cell-surface receptors with predicted serine/threonine kinase activity.ten Dijke P., Ichijo H., Franzen P., Schulz P., Saras J., Toyoshima H., Heldin C.-H., Miyazono K.Oncogene 8:2879-2887(1993) Complete sequencing and characterization of 21,243 full-length human cDNAs.Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S., Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.Nat. Genet. 36:40-45(2004) Structure of the Alk1 extracellular domain and characterization of its bone morphogenetic protein (BMP) binding properties.Mahlawat P., Ilangovan U., Biswas T., Sun L.Z., Hinck A.P.Biochemistry 51:6328-6341(2012) A GDF5 point mutation strikes twice--causing BDA1 and SYNS2.Degenkolbe E., Konig J., Zimmer J., Walther M., Reissner C., Nickel J., Ploger F., Raspopovic J., Sharpe J., Dathe K., Hecht J.T., Mundlos S., Doelken S.C., Seemann P.PLoS Genet. 9:E1003846-E1003846(2013) Crystal structure of the BMP-2-BRIA ectodomain complex.Kirsch T., Sebald W., Dreyer M.K.Nat. Struct. Biol. 7:492-496(2000) Germline mutations of the gene encoding bone morphogenetic protein receptor 1A in juvenile polyposis.Howe J.R., Bair J.L., Sayed M.G., Anderson M.E., Mitros F.A., Petersen G.M., Velculescu V.E., Traverso G., Vogelstein B.Nat. Genet. 28:184-187(2001) Germline mutations in BMPR1A/ALK3 cause a subset of cases of juvenile polyposis syndrome and of Cowden and Bannayan-Riley-Ruvalcaba syndromes.Zhou X.-P., Woodford-Richens K., Lehtonen R., Kurose K., Aldred M., Hampel H., Launonen V., Virta S., Pilarski R., Salovaara R., Bodmer W.F., Conrad B.A., Dunlop M., Hodgson S.V., Iwama T., Jaervinen H., Kellokumpu I., Kim J.C., Leggett B., Markie D., Mecklin J.-P., Neale K., Phillips R., Piris J., Rozen P., Houlston R.S., Aaltonen L.A., Tomlinson I.P.M., Eng C.Am. J. Hum. Genet. 69:704-711(2001) Germline SMAD4 or BMPR1A mutations and phenotype of juvenile polyposis.Sayed M.G., Ahmed A.F., Ringold J.R., Anderson M.E., Bair J.L., Mitros F.A., Lynch H.T., Tinley S.T., Petersen G.M., Giardiello F.M., Vogelstein B., Howe J.R.Ann. Surg. Oncol. 9:901-906(2002) Juvenile polyposis massive gastric polyposis is more common in MADH4 mutation carriers than in BMPR1A mutation carriers.Friedl W., Uhlhaas S., Schulmann K., Stolte M., Loff S., Back W., Mangold E., Stern M., Knaebel H.P., Sutter C., Weber R.G., Pistorius S., Burger B., Propping P.Hum. Genet. 111:108-111(2002) Identification of a novel BMPR1A germline mutation in a Korean juvenile polyposis patient without SMAD4 mutation.Kim I.J., Park J.H., Kang H.C., Kim K.H., Kim J.H., Ku J.L., Kang S.B., Park S.Y., Lee J.S., Park J.G.Clin. Genet. 63:126-130(2003) Contiguous gene deletion within chromosome arm 10q is associated with juvenile polyposis of infancy, reflecting cooperation between the BMPR1A and PTEN tumor-suppressor genes.Delnatte C., Sanlaville D., Mougenot J.-F., Vermeesch J.-R., Houdayer C., Blois M.-C., Genevieve D., Goulet O., Fryns J.-P., Jaubert F., Vekemans M., Lyonnet S., Romana S., Eng C., Stoppa-Lyonnet D.Am. J. Hum. Genet. 78:1066-1074(2006) Mapping of hereditary mixed polyposis syndrome (HMPS) to chromosome 10q23 by genomewide high-density single nucleotide polymorphism (SNP) scan and identification of BMPR1A loss of function.Cao X., Eu K.W., Kumarasinghe M.P., Li H.H., Loi C., Cheah P.Y.J. Med. Genet. 43:E13-E13(2006) Patterns of somatic mutation in human cancer genomes.Greenman C., Stephens P., Smith R., Dalgliesh G.L., Hunter C., Bignell G., Davies H., Teague J., Butler A., Stevens C., Edkins S., O'Meara S., Vastrik I., Schmidt E.E., Avis T., Barthorpe S., Bhamra G., Buck G., Choudhury B., Clements J., Cole J., Dicks E., Forbes S., Gray K., Halliday K., Harrison R., Hills K., Hinton J., Jenkinson A., Jones D., Menzies A., Mironenko T., Perry J., Raine K., Richardson D., Shepherd R., Small A., Tofts C., Varian J., Webb T., West S., Widaa S., Yates A., Cahill D.P., Louis D.N., Goldstraw P., Nicholson A.G., Brasseur F., Looijenga L., Weber B.L., Chiew Y.-E., DeFazio A., Greaves M.F., Green A.R., Campbell P., Birney E., Easton D.F., Chenevix-Trench G., Tan M.-H., Khoo S.K., Teh B.T., Yuen S.T., Leung S.Y., Wooster R., Futreal P.A., Stratton M.R.Nature 446:153-158(2007)

NCBI and Uniprot Product Information

• NCBI GI #: 41349437
• NCBI GeneID: 657
• NCBI Accession #: NP_004320.2
• NCBI GenBank Nucleotide #: NM_004329.2
• UniProt Accession #: P36894; Q8NEN8; A8K6U9
• Molecular Weight: 56.6 kDa
• NCBI Official Full Name: bone morphogenetic protein receptor type-1A
• NCBI Official Synonym Full Names: bone morphogenetic protein receptor type 1A
• NCBI Official Symbol: BMPR1A
• NCBI Official Synonym Symbols: ALK3; SKR5; CD292; ACVRLK3; 10q23del
• NCBI Protein Information: bone morphogenetic protein receptor type-1A
• UniProt Protein Name: Bone morphogenetic protein receptor type-1A
• Protein Family: Bone morphogenetic protein receptor
• UniProt Gene Name: BMPR1A
• UniProt Synonym Gene Names: ACVRLK3; ALK3; BMP type-1A receptor; BMPR-1A; ALK-3; SKR5
• UniProt Entry Name: BMR1A_HUMAN

NCBI Description

The bone morphogenetic protein (BMP) receptors are a family of transmembrane serine/threonine kinases that include the type I receptors BMPR1A and BMPR1B and the type II receptor BMPR2. These receptors are also closely related to the activin receptors, ACVR1 and ACVR2. The ligands of these receptors are members of the TGF-beta superfamily. TGF-betas and activins transduce their signals through the formation of heteromeric complexes with 2 different types of serine (threonine) kinase receptors: type I receptors of about 50-55 kD and type II receptors of about 70-80 kD. Type II receptors bind ligands in the absence of type I receptors, but they require their respective type I receptors for signaling, whereas type I receptors require their respective type II receptors for ligand binding. [provided by RefSeq, Jul 2008]

Uniprot Description

BMPR1A: a serine/threonine-protein kinase receptor for Bone morphogenetic protein-2 and -4 (BMP-2 and BMP-4). Defects in BMPR1A are a cause of juvenile polyposis syndrome (JPS) and Cowden disease (CD), a cancer syndrome characterized by multiple hamartomas and by a high risk for breast, thyroid and endometriel cancers.

Protein type: Membrane protein, integral; Protein kinase, Ser/Thr (receptor); Kinase, protein; EC 2.7.11.30; Protein kinase, TKL; TKL group; STKR family; Type1 subfamily

Chromosomal Location of Human Ortholog: 10q22.3

Cellular Component: caveola; cell soma; dendrite; external side of plasma membrane; integral to membrane; plasma membrane

Molecular Function: ATP binding; glycoprotein binding; metal ion binding; protein binding; protein homodimerization activity; protein serine/threonine kinase activity; receptor signaling protein serine/threonine kinase activity; SMAD binding; transmembrane receptor protein serine/threonine kinase activity

Biological Process: BMP signaling pathway; chondrocyte differentiation; developmental growth; dorsal/ventral axis specification; ectoderm development; embryonic digit morphogenesis; embryonic organ development; hindlimb morphogenesis; immune response; in utero embryonic development; lateral mesoderm development; lung development; mesendoderm development; mesoderm formation; Mullerian duct regression; negative regulation of neurogenesis; neural crest cell development; neural plate mediolateral pattern formation; odontogenesis of dentine-containing teeth; palate development; paraxial mesoderm structural organization; pituitary gland development; positive regulation of bone mineralization; positive regulation of epithelial cell proliferation; positive regulation of mesenchymal cell proliferation; positive regulation of osteoblast differentiation; positive regulation of transcription from RNA polymerase II promoter; protein amino acid phosphorylation; regulation of lateral mesodermal cell fate specification; somitogenesis; stem cell maintenance; transforming growth factor beta receptor signaling pathway

Disease: Juvenile Polyposis Syndrome; Polyposis Syndrome, Hereditary Mixed, 2