Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-PDP2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Jurkat cell lysate)

Rabbit PDP2 Polyclonal Antibody | anti-PDP2 antibody

PDP2 antibody - middle region

Gene Names
PDP2; PPM2B; PDPC 2; PPM2C2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PDP2; Polyclonal Antibody; PDP2 antibody - middle region; anti-PDP2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LQRSILERGFNTEALNIYQFTPPHYYTPPYLTAEPEVTYHRLRPQDKFLV
Sequence Length
529
Applicable Applications for anti-PDP2 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 92%; Horse: 92%; Human: 100%; Mouse: 100%; Rabbit: 92%; Rat: 92%; Zebrafish: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human PDP2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-PDP2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Jurkat cell lysate)

Western Blot (WB) (WB Suggested Anti-PDP2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Jurkat cell lysate)
Related Product Information for anti-PDP2 antibody
This is a rabbit polyclonal antibody against PDP2. It was validated on Western Blot

Target Description: PDP2 catalyzes the dephosphorylation and concomitant reactivation of the alpha subunit of the E1 component of the pyruvate dehydrogenase complex.
Product Categories/Family for anti-PDP2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
60kDa
NCBI Official Full Name
[Pyruvate dehydrogenase
NCBI Official Synonym Full Names
pyruvate dehyrogenase phosphatase catalytic subunit 2
NCBI Official Symbol
PDP2
NCBI Official Synonym Symbols
PPM2B; PDPC 2; PPM2C2
NCBI Protein Information
[Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 2, mitochondrial
UniProt Protein Name
[Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 2, mitochondrial
UniProt Gene Name
PDP2
UniProt Synonym Gene Names
KIAA1348; PDP 2; PDPC 2
UniProt Entry Name
PDP2_HUMAN

NCBI Description

This gene is a mitochondrial protein that functions as a phosphatase and is involved in the enzymatic resetting of the pyruvate dehydrogenase complex. Alternative splicing results in multiple transcript variants encoding the same protein. [provided by RefSeq, Aug 2016]

Uniprot Description

PDP2: a protein phosphoserine phosphatase associated with the mitochondrial matrix that activates phosphorylated pyruvate dehydrogenase complex by dephosphorylation. The PDPs play crucial roles in switching metabolic flux from glycolysis towards oxidative phosphorylation. Catalyzes the dephosphorylation and concomitant reactivation of the alpha subunit of the E1 component of the pyruvate dehydrogenase complex . PDP2 consists of only a catalytic subunit. Belongs to the PP2C family.

Protein type: Protein phosphatase, Ser/Thr (non-receptor); Mitochondrial; EC 3.1.3.43

Chromosomal Location of Human Ortholog: 16q22.1

Cellular Component: mitochondrial matrix

Molecular Function: [pyruvate dehydrogenase (lipoamide)] phosphatase activity; magnesium-dependent protein serine/threonine phosphatase activity; metal ion binding

Biological Process: cellular metabolic process; protein amino acid dephosphorylation; pyruvate metabolic process; regulation of acetyl-CoA biosynthetic process from pyruvate

Research Articles on PDP2

Similar Products

Product Notes

The PDP2 pdp2 (Catalog #AAA3213370) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PDP2 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's PDP2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PDP2 pdp2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LQRSILERGF NTEALNIYQF TPPHYYTPPY LTAEPEVTYH RLRPQDKFLV. It is sometimes possible for the material contained within the vial of "PDP2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.