Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of PDP2 expression in transfected 293T cell line by PDP2 polyclonal antibody. Lane 1: PDP2 transfected lysate (58.19kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human PDP2 Polyclonal Antibody | anti-pdp2 antibody

PDP2 (PPDP 2, [Pyruvate Dehydrogenase [acetyl-transferring]]-phosphatase 2, Mitochondrial, Pyruvate Dehydrogenase Phosphatase Catalytic Subunit 2, PDPC 2, Pyruvate Dehydrogenase Phosphatase Catalytic Subunit 2, PDPC 2, KIAA1348)

Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
PDP2; Polyclonal Antibody; PDP2 (PPDP 2; [Pyruvate Dehydrogenase [acetyl-transferring]]-phosphatase 2; Mitochondrial; Pyruvate Dehydrogenase Phosphatase Catalytic Subunit 2; PDPC 2; KIAA1348); Anti -PDP2 (PPDP 2; anti-pdp2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human PDP2.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MSSTVSYWILNSTRNSIATLQGGRRLYSRYVSNRNKLKWRLFSRVPPTLNSSPCGGFTLCKAYRHTSTEEDDFHLQLSPEQINEVLRAGETTHKILDLESRVPNSVLRFESNQLAANSPVEDRRGVASCLQTNGLMFGIFDGHGGHACAQAVSERLFYYVAVSLMSHQTLEHMEGAMESMKPLLPILHWLKHPGDSIYKDVTSVHLDHLRVYWQELLDLHMEMGLSIEEALMYSFQRLDSDISLEIQAPLEDEVTRNLSLQVAFSGATACMAHVDGIHLHVANAGDCRAILGVQEDNGMWSCLPLTRDHNAWNQAELSRLKREHPESEDRTIIMEDRLLGVLIPCRAFGDVQLKWSKELQRSILERGFNTEALNIYQFTPPHYYTPPYLTAEPEVTYHRLRPQDKFLVLASDGLWDMLSNEDVVRLVVGHLAEADWHKTDLAQRPANLGLMQSLLLQRKASGLHEADQNAATRLIRHAIGNNEYGEMEAERLAAMLTLPEDLARMYRDDITVTVVYFNSESIGAYYKGG
Applicable Applications for anti-pdp2 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human PDP2, aa1-529 (NP_065837.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of PDP2 expression in transfected 293T cell line by PDP2 polyclonal antibody. Lane 1: PDP2 transfected lysate (58.19kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of PDP2 expression in transfected 293T cell line by PDP2 polyclonal antibody. Lane 1: PDP2 transfected lysate (58.19kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-pdp2 antibody
Catalyzes the dephosphorylation and concomitant reactivation of the alpha subunit of the E1 component of the pyruvate dehydrogenase complex.
Product Categories/Family for anti-pdp2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
putative pyruvate dehydrogenase phosphatase isoenzyme 2
NCBI Official Synonym Full Names
putative pyruvate dehydrogenase phosphatase isoenzyme 2
NCBI Official Symbol
pdp2
NCBI Protein Information
[Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 2, mitochondrial; [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 2, mitochondrial

Similar Products

Product Notes

The pdp2 (Catalog #AAA645219) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PDP2 (PPDP 2, [Pyruvate Dehydrogenase [acetyl-transferring]]-phosphatase 2, Mitochondrial, Pyruvate Dehydrogenase Phosphatase Catalytic Subunit 2, PDPC 2, Pyruvate Dehydrogenase Phosphatase Catalytic Subunit 2, PDPC 2, KIAA1348) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PDP2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the pdp2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSSTVSYWIL NSTRNSIATL QGGRRLYSRY VSNRNKLKWR LFSRVPPTLN SSPCGGFTLC KAYRHTSTEE DDFHLQLSPE QINEVLRAGE TTHKILDLES RVPNSVLRFE SNQLAANSPV EDRRGVASCL QTNGLMFGIF DGHGGHACAQ AVSERLFYYV AVSLMSHQTL EHMEGAMESM KPLLPILHWL KHPGDSIYKD VTSVHLDHLR VYWQELLDLH MEMGLSIEEA LMYSFQRLDS DISLEIQAPL EDEVTRNLSL QVAFSGATAC MAHVDGIHLH VANAGDCRAI LGVQEDNGMW SCLPLTRDHN AWNQAELSRL KREHPESEDR TIIMEDRLLG VLIPCRAFGD VQLKWSKELQ RSILERGFNT EALNIYQFTP PHYYTPPYLT AEPEVTYHRL RPQDKFLVLA SDGLWDMLSN EDVVRLVVGH LAEADWHKTD LAQRPANLGL MQSLLLQRKA SGLHEADQNA ATRLIRHAIG NNEYGEMEAE RLAAMLTLPE DLARMYRDDI TVTVVYFNSE SIGAYYKGG. It is sometimes possible for the material contained within the vial of "PDP2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.