Western Blot (WB)
(Host: RabbitTarget Name: GTPBP2Sample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)
Rabbit GTPBP2 Polyclonal Antibody | anti-GTPBP2 antibody
GTPBP2 antibody - N-terminal region
Gene Names
GTPBP2; JABELS
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
GTPBP2; Polyclonal Antibody; GTPBP2 antibody - N-terminal region; anti-GTPBP2 antibody
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GCGGPKGKKKNGRNRGGKANNPPYLPPEAEDGNIEYKLKLVNPSQYRFEH
Sequence Length
602
Applicable Applications for anti-GTPBP2 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Goat: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human GTPBP2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: GTPBP2Sample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: GTPBP2Sample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: GTPBP2Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: GTPBP2Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(WB Suggested Anti-GTPBP2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Transfected 293T)
Western Blot (WB)
(WB Suggested Anti-GTPBP2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Transfected 293T)
Related Product Information for anti-GTPBP2 antibody
This is a rabbit polyclonal antibody against GTPBP2. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: GTP-binding proteins, or G proteins, constitute a superfamily capable of binding GTP or GDP. G proteins are activated by binding GTP and are inactivated by hydrolyzing GTP to GDP. This general mechanism enables G proteins to perform a wide range of biologic activities. GTP-binding proteins, or G proteins, constitute a superfamily capable of binding GTP or GDP. G proteins are activated by binding GTP and are inactivated by hydrolyzing GTP to GDP. This general mechanism enables G proteins to perform a wide range of biologic activities.[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-2966 BC064968.1 1-2966 2967-2996 BU736981.1 1-30 c
Target Description: GTP-binding proteins, or G proteins, constitute a superfamily capable of binding GTP or GDP. G proteins are activated by binding GTP and are inactivated by hydrolyzing GTP to GDP. This general mechanism enables G proteins to perform a wide range of biologic activities. GTP-binding proteins, or G proteins, constitute a superfamily capable of binding GTP or GDP. G proteins are activated by binding GTP and are inactivated by hydrolyzing GTP to GDP. This general mechanism enables G proteins to perform a wide range of biologic activities.[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-2966 BC064968.1 1-2966 2967-2996 BU736981.1 1-30 c
Product Categories/Family for anti-GTPBP2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
66kDa
NCBI Official Full Name
GTP-binding protein 2 isoform a
NCBI Official Synonym Full Names
GTP binding protein 2
NCBI Official Symbol
GTPBP2
NCBI Official Synonym Symbols
JABELS
NCBI Protein Information
GTP-binding protein 2
UniProt Protein Name
GTP-binding protein 2
Protein Family
UniProt Gene Name
GTPBP2
UniProt Entry Name
GTPB2_HUMAN
NCBI Description
GTP-binding proteins, or G proteins, constitute a superfamily capable of binding GTP or GDP. G proteins are activated by binding GTP and are inactivated by hydrolyzing GTP to GDP. This general mechanism enables G proteins to perform a wide range of biologic activities.[supplied by OMIM, Jan 2003]
Uniprot Description
GTPBP2: Belongs to the GTPBP1 GTP-binding protein family. Up-regulated by IFNG/IFN-gamma in human monocytic cell line THP-1. 4 isoforms of the human protein are produced by alternative splicing
Chromosomal Location of Human Ortholog: 6p21
Cellular Component: intracellular membrane-bound organelle
Molecular Function: GTPase activity; protein binding; GTP binding
Biological Process: metabolic process
Research Articles on GTPBP2
Similar Products
Product Notes
The GTPBP2 gtpbp2 (Catalog #AAA3206434) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GTPBP2 antibody - N-terminal region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's GTPBP2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GTPBP2 gtpbp2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GCGGPKGKKK NGRNRGGKAN NPPYLPPEAE DGNIEYKLKL VNPSQYRFEH. It is sometimes possible for the material contained within the vial of "GTPBP2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
