Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

[Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 2 Recombinant Protein | PDP2 recombinant protein

Recombinant Human [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 2, mitochondrial

Gene Names
PDP2; PPM2C2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
[Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 2; Recombinant Human [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 2; mitochondrial; Pyruvate dehydrogenase phosphatase catalytic subunit 2; PDPC 2; PDP2 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
67-529aa; Full Length
Sequence
STEEDDFHLQLSPEQINEVLRAGETTHKILDLESRVPNSVLRFESNQLAANSPVEDRRGVASCLQTNGLMFGIFDGHGGHACAQAVSERLFYYVAVSLMSHQTLEHMEGAMESMKPLLPILHWLKHPGDSIYKDVTSVHLDHLRVYWQELLDLHMEMGLSIEEALMYSFQRLDSDISLEIQAPLEDEVTRNLSLQVAFSGATACMAHVDGIHLHVANAGDCRAILGVQEDNGMWSCLPLTRDHNAWNQAELSRLKREHPESEDRTIIMEDRLLGVLIPCRAFGDVQLKWSKELQRSILERGFNTEALNIYQFTPPHYYTPPYLTAEPEVTYHRLRPQDKFLVLASDGLWDMLSNEDVVRLVVGHLAEADWHKTDLAQRPANLGLMQSLLLQRKASGLHEADQNAATRLIRHAIGNNEYGEMEAERLAAMLTLPEDLARMYRDDITVTVVYFNSESIGAYYKGG
Sequence Length
529
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

SDS-PAGE
Related Product Information for PDP2 recombinant protein
Catalyzes the dephosphorylation and concomitant reactivation of the alpha subunit of the E1 component of the pyruvate dehydrogenase complex.
Product Categories/Family for PDP2 recombinant protein
References
Prediction of the coding sequences of unidentified human genes. XVI. The complete sequences of 150 new cDNA clones from brain which code for large proteins in vitro.Nagase T., Kikuno R., Ishikawa K., Hirosawa M., Ohara O.DNA Res. 7:65-73(2000) Complete sequencing and characterization of 21,243 full-length human cDNAs.Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S., Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.Nat. Genet. 36:40-45(2004)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
56.4 kDa
NCBI Official Full Name
[Pyruvate dehydrogenase
NCBI Official Synonym Full Names
pyruvate dehyrogenase phosphatase catalytic subunit 2
NCBI Official Symbol
PDP2
NCBI Official Synonym Symbols
PPM2C2
NCBI Protein Information
[Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 2, mitochondrial
UniProt Protein Name
[Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 2, mitochondrial
UniProt Gene Name
PDP2
UniProt Synonym Gene Names
KIAA1348; PDP 2; PDPC 2
UniProt Entry Name
PDP2_HUMAN

Uniprot Description

PDP2: a protein phosphoserine phosphatase associated with the mitochondrial matrix that activates phosphorylated pyruvate dehydrogenase complex by dephosphorylation. The PDPs play crucial roles in switching metabolic flux from glycolysis towards oxidative phosphorylation. Catalyzes the dephosphorylation and concomitant reactivation of the alpha subunit of the E1 component of the pyruvate dehydrogenase complex . PDP2 consists of only a catalytic subunit. Belongs to the PP2C family.

Protein type: Protein phosphatase, Ser/Thr (non-receptor); Mitochondrial; EC 3.1.3.43

Chromosomal Location of Human Ortholog: 16q22.1

Cellular Component: mitochondrial matrix

Molecular Function: [pyruvate dehydrogenase (lipoamide)] phosphatase activity; magnesium-dependent protein serine/threonine phosphatase activity; metal ion binding

Biological Process: cellular metabolic process; protein amino acid dephosphorylation; pyruvate metabolic process; regulation of acetyl-CoA biosynthetic process from pyruvate

Research Articles on PDP2

Similar Products

Product Notes

The PDP2 pdp2 (Catalog #AAA1367982) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 67-529aa; Full Length. The amino acid sequence is listed below: STEEDDFHLQ LSPEQINEVL RAGETTHKIL DLESRVPNSV LRFESNQLAA NSPVEDRRGV ASCLQTNGLM FGIFDGHGGH ACAQAVSERL FYYVAVSLMS HQTLEHMEGA MESMKPLLPI LHWLKHPGDS IYKDVTSVHL DHLRVYWQEL LDLHMEMGLS IEEALMYSFQ RLDSDISLEI QAPLEDEVTR NLSLQVAFSG ATACMAHVDG IHLHVANAGD CRAILGVQED NGMWSCLPLT RDHNAWNQAE LSRLKREHPE SEDRTIIMED RLLGVLIPCR AFGDVQLKWS KELQRSILER GFNTEALNIY QFTPPHYYTP PYLTAEPEVT YHRLRPQDKF LVLASDGLWD MLSNEDVVRL VVGHLAEADW HKTDLAQRPA NLGLMQSLLL QRKASGLHEA DQNAATRLIR HAIGNNEYGE MEAERLAAML TLPEDLARMY RDDITVTVVY FNSESIGAYY KGG. It is sometimes possible for the material contained within the vial of "[Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 2, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.