Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-Pde2a AntibodyTitration: 1.0 ug/mlPositive Control: Rat Brain)

Rabbit Pde2a Polyclonal Antibody | anti-PDE2A antibody

Pde2a antibody - N-terminal region

Gene Names
Pde2a; Pde2; Pde2a2; CGS-PDE
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Pde2a; Polyclonal Antibody; Pde2a antibody - N-terminal region; anti-PDE2A antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: CRSQQYPAARPAEPRGQQVFLKPDEPPPQPCADSLQDALLSLGAVIDIAG
Sequence Length
935
Applicable Applications for anti-PDE2A antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide corresponding to a region of Rat
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-Pde2a AntibodyTitration: 1.0 ug/mlPositive Control: Rat Brain)

Western Blot (WB) (WB Suggested Anti-Pde2a AntibodyTitration: 1.0 ug/mlPositive Control: Rat Brain)
Related Product Information for anti-PDE2A antibody
This is a rabbit polyclonal antibody against Pde2a. It was validated on Western Blot

Target Description: The activation of Pde2a induces decreased cAMP accumulation; It is involved in nitric oxide mediated signaling in cardiac fibroblasts.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
104kDa
NCBI Official Full Name
cGMP-dependent 3',5'-cyclic phosphodiesterase isoform PDE2A3
NCBI Official Synonym Full Names
phosphodiesterase 2A
NCBI Official Symbol
Pde2a
NCBI Official Synonym Symbols
Pde2; Pde2a2; CGS-PDE
NCBI Protein Information
cGMP-dependent 3',5'-cyclic phosphodiesterase
UniProt Protein Name
cGMP-dependent 3',5'-cyclic phosphodiesterase
UniProt Gene Name
Pde2a
UniProt Synonym Gene Names
CGS-PDE; cGSPDE
UniProt Entry Name
PDE2A_RAT

NCBI Description

activation induces decreased cAMP accumulation; involved in nitric oxide mediated signaling in cardiac fibroblasts [RGD, Feb 2006]

Uniprot Description

PDE2A: Cyclic nucleotide phosphodiesterase with a dual- specificity for the second messengers cAMP and cGMP, which are key regulators of many important physiological processes. Belongs to the cyclic nucleotide phosphodiesterase family. PDE2 subfamily. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Nucleotide Metabolism - purine; Mitochondrial; EC 3.1.4.17; Phosphodiesterase

Cellular Component: presynaptic membrane; Golgi apparatus; mitochondrial matrix; perinuclear region of cytoplasm; endoplasmic reticulum; axon; dendrite; cytoplasm; plasma membrane; intracellular; nucleus; cytosol; lipid raft

Molecular Function: protein binding; protein homodimerization activity; TPR domain binding; metal ion binding; cGMP-stimulated cyclic-nucleotide phosphodiesterase activity; cyclic-nucleotide phosphodiesterase activity; cGMP binding; drug binding; cAMP binding

Biological Process: monocyte differentiation; metabolic process; cGMP-mediated signaling; cAMP catabolic process; negative regulation of transcription from RNA polymerase II promoter; positive regulation of vascular permeability; negative regulation of cAMP biosynthetic process; cAMP-mediated signaling; negative regulation of protein import into nucleus, translocation; negative regulation of vascular permeability; cGMP catabolic process; regulation of cGMP metabolic process; protein targeting to mitochondrion; positive regulation of inflammatory response

Research Articles on PDE2A

Similar Products

Product Notes

The PDE2A pde2a (Catalog #AAA3212737) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Pde2a antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Pde2a can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PDE2A pde2a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: CRSQQYPAAR PAEPRGQQVF LKPDEPPPQP CADSLQDALL SLGAVIDIAG. It is sometimes possible for the material contained within the vial of "Pde2a, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.