Western Blot (WB)
(WB Suggested Anti-Man2a2 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Liver)
Rabbit Man2a2 Polyclonal Antibody | anti-MAN2A2 antibody
Man2a2 antibody - N-terminal region
Gene Names
Man2a2; MX; Man IIx; AI480988; 1700052O22Rik; 4931438M07Rik
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Man2a2; Polyclonal Antibody; Man2a2 antibody - N-terminal region; anti-MAN2A2 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PQDCQFALGGRGQKPELQMLTVSEDLPFDNVEGGVWRQGFDISYSPNDWD
Sequence Length
827
Applicable Applications for anti-MAN2A2 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide corresponding to a region of Mouse
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-Man2a2 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Liver)
Western Blot (WB)
(WB Suggested Anti-Man2a2 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Liver)
Related Product Information for anti-MAN2A2 antibody
This is a rabbit polyclonal antibody against Man2a2. It was validated on Western Blot
Target Description: The function of this protein remains unknown.
Target Description: The function of this protein remains unknown.
Product Categories/Family for anti-MAN2A2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
93kDa
NCBI Official Full Name
alpha-mannosidase 2x
NCBI Official Synonym Full Names
mannosidase 2, alpha 2
NCBI Official Symbol
Man2a2
NCBI Official Synonym Symbols
MX; Man IIx; AI480988; 1700052O22Rik; 4931438M07Rik
NCBI Protein Information
alpha-mannosidase 2x
UniProt Protein Name
Alpha-mannosidase 2x
Protein Family
UniProt Gene Name
Man2a2
UniProt Synonym Gene Names
Mana2x; Man IIx
UniProt Entry Name
MA2A2_MOUSE
Uniprot Description
Function: Catalyzes the first committed step in the biosynthesis of complex N-glycans. It controls conversion of high mannose to complex N-glycans; the final hydrolytic step in the N-glycan maturation pathway
By similarity.
Catalytic activity: Hydrolysis of the terminal (1->3)- and (1->6)-linked alpha-D-mannose residues in the mannosyl-oligosaccharide Man5(GlcNAc)3.
Cofactor: Binds 1 zinc ion per subunit
By similarity.
Pathway: Protein modification; protein glycosylation.
Subunit structure: Homodimer; disulfide-linked
By similarity.
Subcellular location: Golgi apparatus membrane; Single-pass type II membrane protein
By similarity.
Sequence similarities: Belongs to the glycosyl hydrolase 38 family.
Research Articles on MAN2A2
Similar Products
Product Notes
The MAN2A2 man2a2 (Catalog #AAA3208287) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Man2a2 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Man2a2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MAN2A2 man2a2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PQDCQFALGG RGQKPELQML TVSEDLPFDN VEGGVWRQGF DISYSPNDWD. It is sometimes possible for the material contained within the vial of "Man2a2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
