Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-PDE3A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: MCF7 cell lysate)

Rabbit PDE3A Polyclonal Antibody | anti-PDE3A antibody

PDE3A antibody - N-terminal region

Gene Names
PDE3A; HTNB; CGI-PDE; CGI-PDE A; CGI-PDE-A
Reactivity
Cow, Dog, Horse, Human, Pig, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PDE3A; Polyclonal Antibody; PDE3A antibody - N-terminal region; anti-PDE3A antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LLADPSLPPNVCTSLRAVSNLLSTQLTFQAIHKPRVNPVTSLSENYTCSD
Sequence Length
1141
Applicable Applications for anti-PDE3A antibody
Western Blot (WB)
Homology
Cow: 79%; Dog: 79%; Horse: 86%; Human: 100%; Pig: 79%; Rat: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human PDE3A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-PDE3A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: MCF7 cell lysate)

Western Blot (WB) (WB Suggested Anti-PDE3A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: MCF7 cell lysate)
Related Product Information for anti-PDE3A antibody
This is a rabbit polyclonal antibody against PDE3A. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: PDE3A belongs to the cyclic nucleotide phosphodiesterase family. It hydrolyzes both cyclic AMP (cAMP) and cyclic GMP (cGMP).

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
125kDa
NCBI Official Full Name
cGMP-inhibited 3',5'-cyclic phosphodiesterase A isoform 1
NCBI Official Synonym Full Names
phosphodiesterase 3A
NCBI Official Symbol
PDE3A
NCBI Official Synonym Symbols
HTNB; CGI-PDE; CGI-PDE A; CGI-PDE-A
NCBI Protein Information
cGMP-inhibited 3',5'-cyclic phosphodiesterase A
UniProt Protein Name
cGMP-inhibited 3',5'-cyclic phosphodiesterase A
UniProt Gene Name
PDE3A
UniProt Entry Name
PDE3A_HUMAN

NCBI Description

This gene encodes a member of the cGMP-inhibited cyclic nucleotide phosphodiesterase (cGI-PDE) family. cGI-PDE enzymes hydrolyze both cAMP and cGMP, and play critical roles in many cellular processes by regulating the amplitude and duration of intracellular cyclic nucleotide signals. The encoded protein mediates platelet aggregation and also plays important roles in cardiovascular function by regulating vascular smooth muscle contraction and relaxation. Inhibitors of the encoded protein may be effective in treating congestive heart failure. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Sep 2011]

Research Articles on PDE3A

Similar Products

Product Notes

The PDE3A pde3a (Catalog #AAA3207329) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PDE3A antibody - N-terminal region reacts with Cow, Dog, Horse, Human, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PDE3A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PDE3A pde3a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LLADPSLPPN VCTSLRAVSN LLSTQLTFQA IHKPRVNPVT SLSENYTCSD. It is sometimes possible for the material contained within the vial of "PDE3A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.