Mouse anti-Human, Rat PCSK1N Polyclonal Antibody | anti-PCSK1N antibody

PCSK1N (ProSAAS, Proprotein Convertase Subtilisin/Kexin Type 1 Inhibitor, Proprotein Convertase 1 Inhibitor, pro-SAAS)

Cat. Num. AAA646252

• Gene Names: PCSK1N; SAAS; PROSAAS
• Reactivity: Human, Rat
• Applications: Western Blot
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: PCSK1N; Polyclonal Antibody; PCSK1N (ProSAAS; Proprotein Convertase Subtilisin/Kexin Type 1 Inhibitor; Proprotein Convertase 1 Inhibitor; pro-SAAS); Anti -PCSK1N (ProSAAS; anti-PCSK1N antibody

• Host: Mouse
• Reactivity: Human, Rat
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human PCSK1N. Species Crossreactivity: rat.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MAGSPLLWGPRAGGVGLLVLLLLGLFRPPPALCARPVKEPRGLSAASPPLAETGAPRRFRRSVPRGEAAGAVQELARALAHLLEAERQERARAEAQEAEDQQARVLAQLLRVWGAPRNSDPALGLDDDPDAPAAQLARALLRARLDPAALAAQLVPAPVPAAALRPRPPVYDDGPAGPDAEEAGDETPDVDPELLRYLLGRILAGSADSEGVAAPRRLRRAADHDVGSELPPEGVLGALLRVKRLETPAPQVPARRLLPP

• Applicable Applications for anti-PCSK1N antibody: Western Blot (WB)
• Application Notes: Suitable for use in Western Blot.
• Immunogen: Full length human PCSK1N, aa1-260 (NP_037403.1).
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(PCSK1N polyclonal antibody. Western Blot analysis of PCSK1N expression in rat brain.)

Western Blot (WB)

(Western Blot analysis of PCSK1N expression in transfected 293T cell line by PCSK1N polyclonal antibody. Lane 1: PCSK1N transfected lysate (28.6kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-PCSK1N antibody

May function in the control of the neuroendocrine secretory pathway. Proposed be a specific endogenous inhibitor of PCSK1. ProSAAS and Big PEN-LEN, both containing the C-terminal inhibitory domain, but not the further processed peptides reduce PCSK1 activity in the endoplasmic reticulum and Golgi. It reduces the activity of the 84kD form but not the autocatalytically derived 66kD form of PCSK1. Subsequent processing of proSAAS may eliminate the inhibition. Slows down convertase-mediated processing of proopiomelanocortin and proenkephalin. May control the intracellular timing of PCSK1 rather than its total level of activity. The function of the processed secreted peptides is not known.

Product Categories/Family for anti-PCSK1N antibody

Antibodies; Abs to Protease Inhibitors

NCBI and Uniprot Product Information

• NCBI GI #: 7019519
• NCBI GeneID: 27344
• NCBI Accession #: NP_037403.1
• NCBI GenBank Nucleotide #: NM_013271.4
• UniProt Accession #: Q9UHG2; Q4VC04
• Molecular Weight: 27,372 Da
• NCBI Official Full Name: proSAAS preproprotein
• NCBI Official Synonym Full Names: proprotein convertase subtilisin/kexin type 1 inhibitor
• NCBI Official Symbol: PCSK1N
• NCBI Official Synonym Symbols: SAAS; PROSAAS
• NCBI Protein Information: proSAAS; pro-SAAS; proprotein convertase 1 inhibitor; granin-like neuroendocrine peptide
• UniProt Protein Name: ProSAAS
• Protein Family: ProSAAS
• UniProt Gene Name: PCSK1N
• UniProt Synonym Gene Names: Proprotein convertase 1 inhibitor; b-SAAS; l-SAAS; b-PEN-LEN; l-LEN; b-LEN
• UniProt Entry Name: PCSK1_HUMAN

NCBI Description

The protein encoded by this gene functions as an inhibitor of prohormone convertase 1, which regulates the proteolytic cleavage of neuroendocrine peptide precursors. The proprotein is further processed into multiple short peptides. A polymorphism within this gene may be associated with obesity. [provided by RefSeq, Aug 2013]

Uniprot Description

Function: May function in the control of the neuroendocrine secretory pathway. Proposed be a specific endogenous inhibitor of PCSK1. ProSAAS and Big PEN-LEN, both containing the C-terminal inhibitory domain, but not the further processed peptides reduce PCSK1 activity in the endoplasmic reticulum and Golgi. It reduces the activity of the 84 kDa form but not the autocatalytically derived 66 kDa form of PCSK1. Subsequent processing of proSAAS may eliminate the inhibition. Slows down convertase-mediated processing of proopiomelanocortin and proenkephalin. May control the intracellular timing of PCSK1 rather than its total level of activity. The function of the processed secreted peptides is not known

By similarity.

Subunit structure: Interacts via the C-terminal inhibitory domain with PCSK1 66 kDa form

By similarity.

Subcellular location: Secreted

By similarity. Golgi apparatus › trans-Golgi network

By similarity. Note: A N-terminal processed peptide, probably Big SAAS or Little SAAS, is accumulated in cytoplasmic protein tau deposits in frontotemporal dementia and parkinsonism linked to chromosome 17 (Pick disease), Alzheimer disease and amyotrophic lateral sclerosis-parkinsonism/dementia complex 1 (Guam disease). Ref.4 Ref.5

Tissue specificity: Expressed in brain and pancreas. Ref.1

Domain: ProSAAS(1-180) increases secretion of enzymatically inactive PCSK1

By similarity.The C-terminal inhibitory domain is involved in inhibition of PCSK1. It corresponds to the probable processing intermediate Big PEN-LEN, binds to PCSK1 in vitro and contains the hexapeptide L-L-R-V-K-R, which, as a synthetic peptide, is sufficient for PCSK1 inhibition

By similarity.

Post-translational modification: Proteolytically cleaved in the Golgi. Ref.4O-glycosylated with a core 1 or possibly core 8 glycan. Ref.7 Ref.8