ProSAAS (PCSK1N) Recombinant Protein | PCSK1N recombinant protein

Recombinant Human ProSAAS (PCSK1N)

Cat. Num. AAA1307611

• Gene Names: PCSK1N; SAAS; PROSAAS
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: ProSAAS (PCSK1N); Recombinant Human ProSAAS (PCSK1N); ProSAAS; Proprotein convertase subtilisin/kexin type 1 inhibitor; Proprotein convertase 1 inhibitor; pro-SAASCleaved into the following 7 chains:; 1. KEP; 2. Big SAAS; 3. b-SAAS; 4. Little SAAS; 5. l-SAAS; N-proSAAS; Big PEN-LEN; b-PEN-LEN; SAAS CT(1-49);; PCSK1N recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 34-260, Full length protein
• Sequence: ARPVKEPRGLSAASPPLAETGAPRRFRRSVPRGEAAGAVQELARALAHLLEAERQERARAEAQEAEDQQARVLAQLLRVWGAPRNSDPALGLDDDPDAPAAQLARALLRARLDPAALAAQLVPAPVPAAALRPRPPVYDDGPAGPDAEEAGDETPDVDPELLRYLLGRILAGSADSEGVAAPRRLRRAADHDVGSELPPEGVLGALLRVKRLETPAPQVPARRLLPP
• Sequence Length: 227

• Species: Homo sapiens (Human)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Testing Data

NCBI and Uniprot Product Information

• NCBI GI #: 7019519
• NCBI GeneID: 27344
• NCBI Accession #: NP_037403.1
• NCBI GenBank Nucleotide #: NM_013271.4
• UniProt Accession #: Q9UHG2; Q4VC04
• Molecular Weight: 27,372 Da
• NCBI Official Full Name: proSAAS preproprotein
• NCBI Official Synonym Full Names: proprotein convertase subtilisin/kexin type 1 inhibitor
• NCBI Official Symbol: PCSK1N
• NCBI Official Synonym Symbols: SAAS; PROSAAS
• NCBI Protein Information: proSAAS; pro-SAAS; proprotein convertase 1 inhibitor; granin-like neuroendocrine peptide
• UniProt Protein Name: ProSAAS
• Protein Family: ProSAAS
• UniProt Gene Name: PCSK1N
• UniProt Synonym Gene Names: Proprotein convertase 1 inhibitor; b-SAAS; l-SAAS; b-PEN-LEN; l-LEN; b-LEN
• UniProt Entry Name: PCSK1_HUMAN

NCBI Description

The protein encoded by this gene functions as an inhibitor of prohormone convertase 1, which regulates the proteolytic cleavage of neuroendocrine peptide precursors. The proprotein is further processed into multiple short peptides. A polymorphism within this gene may be associated with obesity. [provided by RefSeq, Aug 2013]

Uniprot Description

PCSK1N: May function in the control of the neuroendocrine secretory pathway. Proposed be a specific endogenous inhibitor of PCSK1. ProSAAS and Big PEN-LEN, both containing the C-terminal inhibitory domain, but not the further processed peptides reduce PCSK1 activity in the endoplasmic reticulum and Golgi. It reduces the activity of the 84 kDa form but not the autocatalytically derived 66 kDa form of PCSK1. Subsequent processing of proSAAS may eliminate the inhibition. Slows down convertase-mediated processing of proopiomelanocortin and proenkephalin. May control the intracellular timing of PCSK1 rather than its total level of activity. The function of the processed secreted peptides is not known.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: Xp11.23

Cellular Component: extracellular space; trans-Golgi network; secretory granule

Molecular Function: serine-type endopeptidase inhibitor activity; endopeptidase inhibitor activity; receptor binding

Biological Process: response to dietary excess; neuropeptide signaling pathway; peptide hormone processing; response to cold