Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (PCGF1 rabbit polyclonal antibody. Western Blot analysis of PCGF1 expression in Jurkat.)

Rabbit anti-Human PCGF1 Polyclonal Antibody | anti-PCGF1 antibody

PCGF1 (Polycomb Group RING Finger Protein 1, Nervous System Polycomb-1, NSPc1, RING Finger Protein 68, NSPC1, RNF68, FLJ43754, MGC10882) (FITC)

Gene Names
PCGF1; NSPC1; RNF68; RNF3A-2; 2010002K04Rik
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PCGF1; Polyclonal Antibody; PCGF1 (Polycomb Group RING Finger Protein 1; Nervous System Polycomb-1; NSPc1; RING Finger Protein 68; NSPC1; RNF68; FLJ43754; MGC10882) (FITC); anti-PCGF1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human PCGF1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein Isothiocyanate (FITC).
Sequence Length
904
Applicable Applications for anti-PCGF1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human PCGF1, aa1-247 (AAH04952.1).
Immunogen Sequence
MRLRNQLQSVYKMDPLRNEEEVRVKIKDLNEHIVCCLCAGYFVDATTITECLHTFCKSCIVKYLQTSKYCPMCNIKIHETQPLLNLKLDRVMQDIVYKLVPGLQDSEEKRIREFYQSRGLDRVTQPTGEEPALSNLGLPFSSFDHSKAHYYRYDEQLNLCLERLSSGKDKNKSVLQNKYVRCSVRAEVRHLRRVLCHRLMLNPQHVQLLFDNEVLPDHMTMKQIWLSRWFGKPSPLLLQYSVKEKRR
Conjugate
FITC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(PCGF1 rabbit polyclonal antibody. Western Blot analysis of PCGF1 expression in Jurkat.)

Western Blot (WB) (PCGF1 rabbit polyclonal antibody. Western Blot analysis of PCGF1 expression in Jurkat.)

Western Blot (WB)

(Western Blot analysis of PCGF1 expression in transfected 293T cell line by PCGF1 polyclonal antibody. Lane 1: PCGF1 transfected lysate (29.2kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of PCGF1 expression in transfected 293T cell line by PCGF1 polyclonal antibody. Lane 1: PCGF1 transfected lysate (29.2kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-PCGF1 antibody
Component of the Polycomb group (PcG) multiprotein BCOR complex, a complex required to maintain the transcriptionally repressive state of some genes, such as BCL6 and the cyclin-dependent kinase inhibitor, CDKN1A. Transcriptional repressor that may be targeted to the DNA by BCL6; this transcription repressor activity may be related to PKC signaling pathway. Represses CDKN1A expression by binding to its promoter, and this repression is dependent on the retinoic acid response element (RARE element). Promotes cell cycle progression and enhances cell proliferation as well. May have a positive role in tumor cell growth by down-regulating CDKN1A. Component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones; it mediates monoubiquitination of histone H2A 'Lys-119', rendering chromatin heritably changed in its expressibility.
Product Categories/Family for anti-PCGF1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Homo sapiens polycomb group ring finger 1, mRNA
NCBI Official Synonym Full Names
polycomb group ring finger 1
NCBI Official Symbol
PCGF1
NCBI Official Synonym Symbols
NSPC1; RNF68; RNF3A-2; 2010002K04Rik
NCBI Protein Information
polycomb group RING finger protein 1

NCBI Description

PCGF1 is a mammalian homolog of the Drosophila polycomb group genes, which act as transcriptional repressors to regulate anterior-posterior patterning in early embryonic development (Nunes et al., 2001 [PubMed 11287196]). See also PCGF2 (MIM 600346).[supplied by OMIM, Aug 2008]

Research Articles on PCGF1

Similar Products

Product Notes

The PCGF1 (Catalog #AAA6388616) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PCGF1 (Polycomb Group RING Finger Protein 1, Nervous System Polycomb-1, NSPc1, RING Finger Protein 68, NSPC1, RNF68, FLJ43754, MGC10882) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PCGF1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PCGF1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PCGF1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.