Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of LAMP3 expression in transfected 293T cell line by LAMP3 polyclonal antibody. Lane 1: LAMP3 transfected lysate (44.3kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human LAMP3 Polyclonal Antibody | anti-LAMP3 antibody

LAMP3 (Lysosome-associated Membrane Glycoprotein 3, LAMP-3, Lysosomal-associated Membrane Protein 3, DC-lysosome-associated Membrane Glycoprotein, DC LAMP, Protein TSC403, CD208, DCLAMP, TSC403)

Gene Names
LAMP3; LAMP; CD208; DCLAMP; LAMP-3; TSC403; DC LAMP; DC-LAMP
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
LAMP3; Polyclonal Antibody; LAMP3 (Lysosome-associated Membrane Glycoprotein 3; LAMP-3; Lysosomal-associated Membrane Protein 3; DC-lysosome-associated Membrane Glycoprotein; DC LAMP; Protein TSC403; CD208; DCLAMP; TSC403); Anti -LAMP3 (Lysosome-associated Membrane Glycoprotein 3; anti-LAMP3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human LAMP3.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MPRQLSAAAALFASLAVILHDGSQMRAKAFPGTRDYSQPTAAATVQDIKKPVQQPAKQAPHQTLAARFMDGHITFQTAATVKIPTTTPATTKNTATTSPITYTLVTTQATPNNSHTAPPVTEVTVGPSLAPYSLPPTITPPAHTTGTSSSTVSHTTGNTTQPSNQTTLPATLSIALHKSTTGQKPVQPTHAPGTTAAAHNTTRTAAPASTVPGPTLAPQPSSVKTGIYQVLNGSRLCIKAEMGIQLIVQDKESVFSPRRYFNIDPNATQASGNCGTRKSNLLLNFQGGFVNLTFTKDEESYYISEVGAYLTVSDPETVYQGIKHAVVMFQTAVGHSFKCVSEQSLQLSAHLQVKTTDVQLQAFDFEDDHFGNVDECSSDYTIVLPVIGAIVVGLCLMGMGVYKIRLRCQSSGYQRI
Applicable Applications for anti-LAMP3 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human LAMP3, aa1-416 (AAH32940.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of LAMP3 expression in transfected 293T cell line by LAMP3 polyclonal antibody. Lane 1: LAMP3 transfected lysate (44.3kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of LAMP3 expression in transfected 293T cell line by LAMP3 polyclonal antibody. Lane 1: LAMP3 transfected lysate (44.3kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-LAMP3 antibody
May play a role in dendritic cell function and in adaptive immunity.
Product Categories/Family for anti-LAMP3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44,346 Da
NCBI Official Full Name
lysosome-associated membrane glycoprotein 3
NCBI Official Synonym Full Names
lysosomal-associated membrane protein 3
NCBI Official Symbol
LAMP3
NCBI Official Synonym Symbols
LAMP; CD208; DCLAMP; LAMP-3; TSC403; DC LAMP; DC-LAMP
NCBI Protein Information
lysosome-associated membrane glycoprotein 3; DC-lysosome-associated membrane glycoprotein
UniProt Protein Name
Lysosome-associated membrane glycoprotein 3
UniProt Gene Name
LAMP3
UniProt Synonym Gene Names
DCLAMP; TSC403; LAMP-3; Lysosomal-associated membrane protein 3; DC LAMP
UniProt Entry Name
LAMP3_HUMAN

NCBI Description

Dendritic cells (DCs) are the most potent antigen-presenting cells. Immature DCs efficiently capture antigens and differentiate into interdigitating dendritic cells (IDCs) in lymphoid tissues that induce primary T-cell responses (summary by de Saint-Vis et al., 1998 [PubMed 9768752]).[supplied by OMIM, Dec 2010]

Uniprot Description

LAMP3: Might change the lysosome function after the transfer of peptide-MHC class II molecules to the surface of dendritic cells. Belongs to the LAMP family.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 3q26.3-q27

Cellular Component: lysosomal membrane; integral to membrane

Biological Process: cell proliferation; immune system process

Research Articles on LAMP3

Similar Products

Product Notes

The LAMP3 lamp3 (Catalog #AAA6008743) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The LAMP3 (Lysosome-associated Membrane Glycoprotein 3, LAMP-3, Lysosomal-associated Membrane Protein 3, DC-lysosome-associated Membrane Glycoprotein, DC LAMP, Protein TSC403, CD208, DCLAMP, TSC403) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's LAMP3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the LAMP3 lamp3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MPRQLSAAAA LFASLAVILH DGSQMRAKAF PGTRDYSQPT AAATVQDIKK PVQQPAKQAP HQTLAARFMD GHITFQTAAT VKIPTTTPAT TKNTATTSPI TYTLVTTQAT PNNSHTAPPV TEVTVGPSLA PYSLPPTITP PAHTTGTSSS TVSHTTGNTT QPSNQTTLPA TLSIALHKST TGQKPVQPTH APGTTAAAHN TTRTAAPAST VPGPTLAPQP SSVKTGIYQV LNGSRLCIKA EMGIQLIVQD KESVFSPRRY FNIDPNATQA SGNCGTRKSN LLLNFQGGFV NLTFTKDEES YYISEVGAYL TVSDPETVYQ GIKHAVVMFQ TAVGHSFKCV SEQSLQLSAH LQVKTTDVQL QAFDFEDDHF GNVDECSSDY TIVLPVIGAI VVGLCLMGMG VYKIRLRCQS SGYQRI. It is sometimes possible for the material contained within the vial of "LAMP3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.