Rabbit anti-Human PCGF1 Polyclonal Antibody | anti-PCGF1 antibody

PCGF1 (Polycomb Group RING Finger Protein 1, Nervous System Polycomb-1, NSPc1, RING Finger Protein 68, NSPC1, RNF68, FLJ43754, MGC10882) (PE)

Cat. Num. AAA6388623

• Gene Names: PCGF1; NSPC1; RNF68; RNF3A-2; 2010002K04Rik
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: PCGF1; Polyclonal Antibody; PCGF1 (Polycomb Group RING Finger Protein 1; Nervous System Polycomb-1; NSPc1; RING Finger Protein 68; NSPC1; RNF68; FLJ43754; MGC10882) (PE); anti-PCGF1 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human PCGF1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
• Sequence Length: 904

• Applicable Applications for anti-PCGF1 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human PCGF1, aa1-247 (AAH04952.1).
• Immunogen Sequence: MRLRNQLQSVYKMDPLRNEEEVRVKIKDLNEHIVCCLCAGYFVDATTITECLHTFCKSCIVKYLQTSKYCPMCNIKIHETQPLLNLKLDRVMQDIVYKLVPGLQDSEEKRIREFYQSRGLDRVTQPTGEEPALSNLGLPFSSFDHSKAHYYRYDEQLNLCLERLSSGKDKNKSVLQNKYVRCSVRAEVRHLRRVLCHRLMLNPQHVQLLFDNEVLPDHMTMKQIWLSRWFGKPSPLLLQYSVKEKRR
• Conjugate: PE
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(PCGF1 rabbit polyclonal antibody. Western Blot analysis of PCGF1 expression in Jurkat.)

Western Blot (WB)

(Western Blot analysis of PCGF1 expression in transfected 293T cell line by PCGF1 polyclonal antibody. Lane 1: PCGF1 transfected lysate (29.2kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-PCGF1 antibody

Component of the Polycomb group (PcG) multiprotein BCOR complex, a complex required to maintain the transcriptionally repressive state of some genes, such as BCL6 and the cyclin-dependent kinase inhibitor, CDKN1A. Transcriptional repressor that may be targeted to the DNA by BCL6; this transcription repressor activity may be related to PKC signaling pathway. Represses CDKN1A expression by binding to its promoter, and this repression is dependent on the retinoic acid response element (RARE element). Promotes cell cycle progression and enhances cell proliferation as well. May have a positive role in tumor cell growth by down-regulating CDKN1A. Component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones; it mediates monoubiquitination of histone H2A 'Lys-119', rendering chromatin heritably changed in its expressibility.

Product Categories/Family for anti-PCGF1 antibody

Antibodies; Transcription Factors; Zinc (Ring) Finger

NCBI and Uniprot Product Information

• NCBI GI #: 13436325
• NCBI GeneID: 84759
• NCBI Official Full Name: Homo sapiens polycomb group ring finger 1, mRNA
• NCBI Official Synonym Full Names: polycomb group ring finger 1
• NCBI Official Symbol: PCGF1
• NCBI Official Synonym Symbols: NSPC1; RNF68; RNF3A-2; 2010002K04Rik
• NCBI Protein Information: polycomb group RING finger protein 1
• Protein Family: Polycomb group RING finger protein

NCBI Description

PCGF1 is a mammalian homolog of the Drosophila polycomb group genes, which act as transcriptional repressors to regulate anterior-posterior patterning in early embryonic development (Nunes et al., 2001 [PubMed 11287196]). See also PCGF2 (MIM 600346).[supplied by OMIM, Aug 2008]