Western Blot (WB)
(WB Suggested Anti-ODF4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Thymus)
Rabbit anti-Human ODF4 Polyclonal Antibody | anti-ODF4 antibody
ODF4 antibody - N-terminal region
Gene Names
ODF4; CT134; CT136; OPPO1
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ODF4; Polyclonal Antibody; ODF4 antibody - N-terminal region; anti-ODF4 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MDAEYSGNEFPRSEGERDQHQRPGKERKSGEAGWGTGELGQDGRLLSSTL
Sequence Length
257
Applicable Applications for anti-ODF4 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human ODF4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-ODF4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Thymus)
Western Blot (WB)
(WB Suggested Anti-ODF4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Thymus)
Related Product Information for anti-ODF4 antibody
This is a rabbit polyclonal antibody against ODF4. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: ODF4 is the component of the outer dense fibers (ODF) of spermatozoa which could be involved in sperm tail structure, sperm movement and general organization of cellular cytoskeleton.This gene encodes a protein that is localized in the outer dense fibers of the tails of mature sperm. This protein is thought to have some important role in the sperm tail. Sequence Note: The RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.
Target Description: ODF4 is the component of the outer dense fibers (ODF) of spermatozoa which could be involved in sperm tail structure, sperm movement and general organization of cellular cytoskeleton.This gene encodes a protein that is localized in the outer dense fibers of the tails of mature sperm. This protein is thought to have some important role in the sperm tail. Sequence Note: The RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.
Product Categories/Family for anti-ODF4 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29kDa
NCBI Official Full Name
outer dense fiber protein 4 isoform 1
NCBI Official Synonym Full Names
outer dense fiber of sperm tails 4
NCBI Official Symbol
ODF4
NCBI Official Synonym Symbols
CT134; CT136; OPPO1
NCBI Protein Information
outer dense fiber protein 4
UniProt Protein Name
Outer dense fiber protein 4
Protein Family
UniProt Gene Name
ODF4
UniProt Synonym Gene Names
OPPO1; hOPPO1
UniProt Entry Name
ODFP4_HUMAN
NCBI Description
This gene encodes a protein that is localized in the outer dense fibers of the tails of mature sperm. This protein is thought to have some important role in the sperm tail. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2016]
Research Articles on ODF4
Similar Products
Product Notes
The ODF4 odf4 (Catalog #AAA3211146) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ODF4 antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ODF4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ODF4 odf4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MDAEYSGNEF PRSEGERDQH QRPGKERKSG EAGWGTGELG QDGRLLSSTL. It is sometimes possible for the material contained within the vial of "ODF4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
