Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (ODF4 antibody (MBS839167) used at 1 ug/ml to detect target protein.)

Rabbit ODF4 Polyclonal Antibody | anti-ODF4 antibody

ODF4 antibody

Gene Names
ODF4; CT134; CT136; OPPO1
Applications
Western Blot
Purity
Affinity purified
Synonyms
ODF4; Polyclonal Antibody; ODF4 antibody; Polyclonal ODF4; Anti-ODF4; ODF-4; MGC138215; OPPO1; ODF 4; Outer Dense Fiber Of Sperm Tails 4; MGC138219; anti-ODF4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Clonality
Polyclonal
Specificity
ODF4 antibody was raised against the N terminal of ODF4
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ODF4 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
257
Applicable Applications for anti-ODF4 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
ODF4 is the component of the outer dense fibers (ODF) of spermatozoa which could be involved in sperm tail structure, sperm movement and general organization of cellular cytoskeleton.
Cross-Reactivity
Human
Immunogen
ODF4 antibody was raised using the N terminal of ODF4 corresponding to a region with amino acids MDAEYSGNEFPRSEGERDQHQRPGKERKSGEAGWGTGELGQDGRLLSSTL
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(ODF4 antibody (MBS839167) used at 1 ug/ml to detect target protein.)

Western Blot (WB) (ODF4 antibody (MBS839167) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-ODF4 antibody
Rabbit polyclonal ODF4 antibody raised against the N terminal of ODF4
Product Categories/Family for anti-ODF4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
29 kDa (MW of target protein)
NCBI Official Full Name
outer dense fiber protein 4
NCBI Official Synonym Full Names
outer dense fiber of sperm tails 4
NCBI Official Symbol
ODF4
NCBI Official Synonym Symbols
CT134; CT136; OPPO1
NCBI Protein Information
outer dense fiber protein 4
UniProt Protein Name
Outer dense fiber protein 4
Protein Family
UniProt Gene Name
ODF4
UniProt Synonym Gene Names
OPPO1; hOPPO1
UniProt Entry Name
ODFP4_HUMAN

NCBI Description

This gene encodes a protein that is localized in the outer dense fibers of the tails of mature sperm. This protein is thought to have some important role in the sperm tail. [provided by RefSeq, Jul 2008]

Uniprot Description

ODF4: Component of the outer dense fibers (ODF) of spermatozoa which could be involved in sperm tail structure, sperm movement and general organization of cellular cytoskeleton.

Protein type: Cancer Testis Antigen (CTA); Membrane protein, multi-pass; Membrane protein, integral

Chromosomal Location of Human Ortholog: 17p13.1

Cellular Component: integral to membrane; outer dense fiber

Biological Process: multicellular organismal development; spermatogenesis; cell differentiation

Research Articles on ODF4

Similar Products

Product Notes

The ODF4 odf4 (Catalog #AAA839167) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's ODF4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the ODF4 odf4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ODF4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.