Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-NMBR Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human brain)

Rabbit anti-Human NMBR Polyclonal Antibody | anti-NMBR antibody

NMBR antibody - N-terminal region

Gene Names
NMBR; BB1; BB1R; NMB-R
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
NMBR; Polyclonal Antibody; NMBR antibody - N-terminal region; anti-NMBR antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PSKSLSNLSVTTGANESGSVPEGWERDFLPASDGTTTELVIRCVIPSLYL
Sequence Length
390
Applicable Applications for anti-NMBR antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human NMBR
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-NMBR Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human brain)

Western Blot (WB) (WB Suggested Anti-NMBR Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human brain)
Related Product Information for anti-NMBR antibody
This is a rabbit polyclonal antibody against NMBR. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Neuromedin B receptor binds neuromedin B, a potent mitogen and growth factor for normal and neoplastic lung and for gastrointestinal epithelial tissue.Neuromedin B receptor binds neuromedin B, a potent mitogen and growth factor for normal and neoplastic lung and for gastrointestinal epithelial tissue. Sequence Note: This RefSeq record was created from transcript and genomic sequence data because transcript sequence consistent with the reference genome assembly was not available for all regions of the RefSeq transcript. The extent of this transcript is supported by transcript alignments. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-100 AL589674.9 90178-90277 c 101-1308 M73482.1 99-1306 1309-1354 AL589674.9 77086-77131 c This locus represents an antisense transcript of the survivin locus. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-270 AF086186.1 11-280 271-869 AC087645.19 118062-118660 870-1098 L26245.1 740-968 1099-1286 BM839824.1 1-188 c
Product Categories/Family for anti-NMBR antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43kDa
NCBI Official Full Name
neuromedin-B receptor isoform a
NCBI Official Synonym Full Names
neuromedin B receptor
NCBI Official Symbol
NMBR
NCBI Official Synonym Symbols
BB1; BB1R; NMB-R
NCBI Protein Information
neuromedin-B receptor
UniProt Protein Name
Neuromedin-B receptor
Protein Family
UniProt Gene Name
NMBR
UniProt Synonym Gene Names
NMB-R
UniProt Entry Name
NMBR_HUMAN

NCBI Description

This gene encodes a 7-transmembrane G protein-coupled receptor that binds neuromedin B, which is a growth factor and mitogen for gastrointestinal epithelial tissue and for normal and neoplastic lung. This receptor may play a role in smooth muscle contraction, neuronal responses, and the regulation of cell growth. Antagonists of this receptor have a potential therapeutic use in inhibiting tumor cell growth. Polymorphisms in this gene may be associated with a susceptibility for schizophrenia. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Apr 2016]

Uniprot Description

NMBR: Receptor for neuromedin-B. Belongs to the G-protein coupled receptor 1 family.

Protein type: Membrane protein, integral; GPCR, family 1; Receptor, GPCR; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 6q24.1

Cellular Component: integral to plasma membrane; cytoplasm; plasma membrane

Molecular Function: bombesin receptor activity

Biological Process: G-protein coupled receptor protein signaling pathway; bombesin receptor signaling pathway; G-protein signaling, coupled to IP3 second messenger (phospholipase C activating)

Research Articles on NMBR

Similar Products

Product Notes

The NMBR nmbr (Catalog #AAA3213922) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NMBR antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NMBR can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NMBR nmbr for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PSKSLSNLSV TTGANESGSV PEGWERDFLP ASDGTTTELV IRCVIPSLYL. It is sometimes possible for the material contained within the vial of "NMBR, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.