Mouse anti-Human ODF2 Monoclonal Antibody | anti-ODF2 antibody

ODF2 (Outer Dense Fiber Protein 2, Cenexin, Outer Dense Fiber of Sperm Tails Protein 2) (Biotin)

Cat. Num. AAA6143305

• Gene Names: ODF2; CT134; ODF84; ODF2/1; ODF2/2
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: ODF2; Monoclonal Antibody; ODF2 (Outer Dense Fiber Protein 2; Cenexin; Outer Dense Fiber of Sperm Tails Protein 2) (Biotin); anti-ODF2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1A1
• Specificity: Recognizes human ODF2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-ODF2 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa706-805 from human ODF2 (NP_002531) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: KEHALSKERAAQNKILDLETQLSRTKTELSQLRRSRDDADRRYQSRLQDLKDRLEQSESTNRSMQNYVQFLKSSYANVFGDGPYSTFLTSSPIRSRSPP
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.63kD).)

Western Blot (WB)

(Western Blot analysis of ODF2 expression in transfected 293T cell line by ODF2 monoclonal antibody. Lane 1: ODF2 transfected lysate (93.3kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-ODF2 antibody

Seems to be a major component of sperm tail outer dense fibers (ODF). ODFs are filamentous structures located on the outside of the axoneme in the midpiece and principal piece of the mammalian sperm tail and may help to maintain the passive elastic structures and elastic recoil of the sperm tail. May have a modulating influence on sperm motility. Functions as a general scaffold protein that is specifically localized at the distal/subdistal appendages of mother centrioles. Component of the centrosome matrix required for the localization of PLK1 and NIN to the centrosomes. Required for the formation and/or maintenance of normal CETN1 assembly.

Product Categories/Family for anti-ODF2 antibody

Antibodies; Centromeres

NCBI and Uniprot Product Information

• NCBI GI #: 24430181
• NCBI GeneID: 4957
• NCBI Accession #: NP_002531
• NCBI GenBank Nucleotide #: NM_002540
• UniProt Accession #: Q5BJF6
• Molecular Weight: 89kDa
• NCBI Official Full Name: outer dense fiber protein 2 isoform 9
• NCBI Official Synonym Full Names: outer dense fiber of sperm tails 2
• NCBI Official Symbol: ODF2
• NCBI Official Synonym Symbols: CT134; ODF84; ODF2/1; ODF2/2
• NCBI Protein Information: outer dense fiber protein 2
• UniProt Protein Name: Outer dense fiber protein 2
• Protein Family: Outer dense fiber protein
• UniProt Gene Name: ODF2
• UniProt Entry Name: ODFP2_HUMAN

NCBI Description

The outer dense fibers are cytoskeletal structures that surround the axoneme in the middle piece and principal piece of the sperm tail. The fibers function in maintaining the elastic structure and recoil of the sperm tail as well as in protecting the tail from shear forces during epididymal transport and ejaculation. Defects in the outer dense fibers lead to abnormal sperm morphology and infertility. This gene encodes one of the major outer dense fiber proteins. Alternative splicing results in multiple transcript variants. The longer transcripts, also known as 'Cenexins', encode proteins with a C-terminal extension that are differentially targeted to somatic centrioles and thought to be crucial for the formation of microtubule organizing centers. [provided by RefSeq, Oct 2010]