Mouse anti-Human LZTFL1 Monoclonal Antibody | anti-LZTFL1 antibody

LZTFL1 (Leucine Zipper Transcription Factor-Like Protein 1, FLJ36386, 5530402H04Rik, 6130400H19Rik, MGC106871, MGC108960) (HRP)

Cat. Num. AAA6153381

• Gene Names: LZTFL1; BBS17
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: LZTFL1; Monoclonal Antibody; LZTFL1 (Leucine Zipper Transcription Factor-Like Protein 1; FLJ36386; 5530402H04Rik; 6130400H19Rik; MGC106871; MGC108960) (HRP); anti-LZTFL1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 7F6
• Specificity: Recognizes human LZTFL1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-LZTFL1 antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 3ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa200-300 from human LZTFL1 (NP_065080) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: KDFIKAQDLSNLENTVAALKSEFQKTLNDKTENQKSLEENLATAKHDLLRVQEQLHMAEKELEKKFQQTAAYRNMKEILTKKNDQIKDLRKRLAQYEPED
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB)

(Western Blot analysis of LZTFL1 expression in transfected 293T cell line by LZTFL1 monoclonal antibody. Lane 1: LZTFL1 transfected lysate (34.6kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to LZTFL1 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3ug/ml].)

Immunofluorescence (IF)

(Immunofluorescence of monoDetection limit for recombinant GST tagged LZTFL1 is ~0.1ng/ml as a capture antibody.clonal antibody to LZTFL1 on HeLa cell. [antibody concentration 25ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged LZTFL1 is ~0.1ng/ml as a capture antibody.)

Western Blot (WB)

(LZTFL1 monoclonal antibody, Western Blot analysis of LZTFL1 expression in HeLa.)

Product Categories/Family for anti-LZTFL1 antibody

Antibodies; Transcription Factors

References

1. A Novel Protein LZTFL1 Regulates Ciliary Trafficking of the BBSome and Smoothened. Seo S, Zhang Q, Bugge K, Breslow DK, Searby CC, Nachury MV, Sheffield VC.PLoS Genet. 2011 Nov;7(11):e1002358. Epub 2011 Nov 3.

NCBI and Uniprot Product Information

• NCBI GI #: 9966793
• NCBI GeneID: 54585
• NCBI Accession #: NP_065080
• NCBI GenBank Nucleotide #: NM_020347
• UniProt Accession #: Q9NQ48; Q8TC61; Q9NQ56; B3KSI9; B4E0K7
• Molecular Weight: 37.0kDa (322aa) confirmed by MALDI-TOF
• NCBI Official Full Name: leucine zipper transcription factor-like protein 1 isoform 1
• NCBI Official Synonym Full Names: leucine zipper transcription factor like 1
• NCBI Official Symbol: LZTFL1
• NCBI Official Synonym Symbols: BBS17
• NCBI Protein Information: leucine zipper transcription factor-like protein 1
• UniProt Protein Name: Leucine zipper transcription factor-like protein 1
• Protein Family: Leucine zipper transcription factor-like protein
• UniProt Gene Name: LZTFL1
• UniProt Entry Name: LZTL1_HUMAN

NCBI Description

This gene encodes a ubiquitously expressed protein that localizes to the cytoplasm. This protein interacts with Bardet-Biedl Syndrome (BBS) proteins and, through its interaction with BBS protein complexes, regulates protein trafficking to the ciliary membrane. Nonsense mutations in this gene cause a form of Bardet-Biedl Syndrome; a ciliopathy characterized in part by polydactyly, obesity, cognitive impairment, hypogonadism, and kidney failure. This gene may also function as a tumor suppressor; possibly by interacting with E-cadherin and the actin cytoskeleton and thereby regulating the transition of epithelial cells to mesenchymal cells. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Feb 2013]

Uniprot Description

LZTFL1: Belongs to the LZTFL1 family.

Chromosomal Location of Human Ortholog: 3p21.3

Cellular Component: cytosol

Molecular Function: identical protein binding; protein binding; protein complex binding

Disease: Bardet-biedl Syndrome 17