Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (OAS1 rabbit polyclonal antibody. Western Blot analysis of OAS1 expression in MCF-7.)

Rabbit anti-Human OAS1 Polyclonal Antibody | anti-OAS1 antibody

OAS1 (2', 5'-Oligoadenylate Synthetase 1, (2-5')oligo(A) Synthase 1, 2-5A Synthase 1, E18/E16, p46/p42 OAS, OIAS) APC

Gene Names
OAS1; OIAS; IFI-4; OIASI
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
OAS1; Polyclonal Antibody; OAS1 (2'; 5'-Oligoadenylate Synthetase 1; (2-5')oligo(A) Synthase 1; 2-5A Synthase 1; E18/E16; p46/p42 OAS; OIAS) APC; anti-OAS1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human OAS1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-OAS1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human OAS1, aa1-400 (NP_058132.2).
Immunogen Sequence
MMDLRNTPAKSLDKFIEDYLLPDTCFRMQINHAIDIICGFLKERCFRGSSYPVCVSKVVKGGSSGKGTTLRGRSDADLVVFLSPLTTFQDQLNRRGEFIQEIRRQLEACQRERAFSVKFEVQAPRWGNPRALSFVLSSLQLGEGVEFDVLPAFDALGQLTGGYKPNPQIYVKLIEECTDLQKEGEFSTCFTELQRDFLKQRPTKLKSLIRLVKHWYQNCKKKLGKLPPQYALELLTVYAWERGSMKTHFNTAQGFRTVLELVINYQQLCIYWTKYYDFKNPIIEKYLRRQLTKPRPVILDPADPTGNLGGGDPKGWRQLAQEAEAWLNYPCFKNWDGSPVSSWILLAESNSADDETDDPRRYQKYGYIGTHEYPHFSHRPSTLQAASTPQAEEDWTCTIL
Conjugate
APC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(OAS1 rabbit polyclonal antibody. Western Blot analysis of OAS1 expression in MCF-7.)

Western Blot (WB) (OAS1 rabbit polyclonal antibody. Western Blot analysis of OAS1 expression in MCF-7.)

Western Blot (WB)

(Western Blot analysis of OAS1 expression in transfected 293T cell line by OAS1 polyclonal antibody. Lane 1: OAS1 transfected lysate (46kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of OAS1 expression in transfected 293T cell line by OAS1 polyclonal antibody. Lane 1: OAS1 transfected lysate (46kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-OAS1 antibody
This protein is an enzyme included in the 2', 5' oligoadenylate synthase family. This enzyme is induced by interferons and catalyzes the 2', 5' oligomers of adenosine in order to bind and activate RNase L. This enzyme family plays a significant role in the inhibition of cellular protein synthesis and viral infection resistance.
Product Categories/Family for anti-OAS1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
43,944 Da
NCBI Official Full Name
2'-5'-oligoadenylate synthase 1 isoform 1
NCBI Official Synonym Full Names
2'-5'-oligoadenylate synthetase 1, 40/46kDa
NCBI Official Symbol
OAS1
NCBI Official Synonym Symbols
OIAS; IFI-4; OIASI
NCBI Protein Information
2'-5'-oligoadenylate synthase 1; E18/E16; p46/p42 OAS; 2-5A synthase 1; 2-5A synthetase 1; (2-5')oligo(A) synthase 1; 2',5'-oligo A synthetase 1; (2-5')oligo(A) synthetase 1; 2'-5'-oligoisoadenylate synthetase 1; 2',5'-oligoadenylate synthetase 1, 40/46kD
UniProt Protein Name
2'-5'-oligoadenylate synthase 1
UniProt Gene Name
OAS1
UniProt Synonym Gene Names
OIAS; (2-5')oligo(A) synthase 1; 2-5A synthase 1
UniProt Entry Name
OAS1_HUMAN

NCBI Description

This gene encodes a member of the 2-5A synthetase family, essential proteins involved in the innate immune response to viral infection. The encoded protein is induced by interferons and uses adenosine triphosphate in 2'-specific nucleotidyl transfer reactions to synthesize 2',5'-oligoadenylates (2-5As). These molecules activate latent RNase L, which results in viral RNA degradation and the inhibition of viral replication. The three known members of this gene family are located in a cluster on chromosome 12. Mutations in this gene have been associated with host susceptibility to viral infection. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jul 2008]

Uniprot Description

OAS1: Interferon-induced, dsRNA-activated antiviral enzyme which plays a critical role in cellular innate antiviral response. In addition, it may also play a role in other cellular processes such as apoptosis, cell growth, differentiation and gene regulation. Synthesizes higher oligomers of 2'-5'-oligoadenylates (2-5A) from ATP which then bind to the inactive monomeric form of ribonuclease L (RNase L) leading to its dimerization and subsequent activation. Activation of RNase L leads to degradation of cellular as well as viral RNA, resulting in the inhibition of protein synthesis, thus terminating viral replication. Can mediate the antiviral effect via the classical RNase L-dependent pathway or an alternative antiviral pathway independent of RNase L. The secreted form displays antiviral effect against vesicular stomatitis virus (VSV), herpes simplex virus type 2 (HSV-2), and encephalomyocarditis virus (EMCV) and stimulates the alternative antiviral pathway independent of RNase L. Belongs to the 2-5A synthase family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Transferase; EC 2.7.7.84

Chromosomal Location of Human Ortholog: 12q24.2

Cellular Component: mitochondrion; endoplasmic reticulum; cytoplasm; extracellular region; cytosol; nucleus

Molecular Function: protein binding; zinc ion binding; metal ion binding; double-stranded RNA binding; ATP binding; 2'-5'-oligoadenylate synthetase activity

Biological Process: negative regulation of viral genome replication; response to virus; cytokine and chemokine mediated signaling pathway; glucose metabolic process; purine nucleotide biosynthetic process; glucose homeostasis; defense response to virus; protein oligomerization

Disease: Diabetes Mellitus, Insulin-dependent

Research Articles on OAS1

Similar Products

Product Notes

The OAS1 oas1 (Catalog #AAA6387877) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The OAS1 (2', 5'-Oligoadenylate Synthetase 1, (2-5')oligo(A) Synthase 1, 2-5A Synthase 1, E18/E16, p46/p42 OAS, OIAS) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's OAS1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the OAS1 oas1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "OAS1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.