Rabbit anti-Human OAS1 Polyclonal Antibody | anti-OAS1 antibody

OAS1 (2', 5'-Oligoadenylate Synthetase 1, (2-5')oligo(A) Synthase 1, 2-5A Synthase 1, E18/E16, p46/p42 OAS, OIAS) (HRP)

Cat. Num. AAA6387880

• Gene Names: OAS1; OIAS; IFI-4; OIASI
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: OAS1; Polyclonal Antibody; OAS1 (2'; 5'-Oligoadenylate Synthetase 1; (2-5')oligo(A) Synthase 1; 2-5A Synthase 1; E18/E16; p46/p42 OAS; OIAS) (HRP); anti-OAS1 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human OAS1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Horseradish Peroxidase (HRP).

• Applicable Applications for anti-OAS1 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human OAS1, aa1-400 (NP_058132.2).
• Immunogen Sequence: MMDLRNTPAKSLDKFIEDYLLPDTCFRMQINHAIDIICGFLKERCFRGSSYPVCVSKVVKGGSSGKGTTLRGRSDADLVVFLSPLTTFQDQLNRRGEFIQEIRRQLEACQRERAFSVKFEVQAPRWGNPRALSFVLSSLQLGEGVEFDVLPAFDALGQLTGGYKPNPQIYVKLIEECTDLQKEGEFSTCFTELQRDFLKQRPTKLKSLIRLVKHWYQNCKKKLGKLPPQYALELLTVYAWERGSMKTHFNTAQGFRTVLELVINYQQLCIYWTKYYDFKNPIIEKYLRRQLTKPRPVILDPADPTGNLGGGDPKGWRQLAQEAEAWLNYPCFKNWDGSPVSSWILLAESNSADDETDDPRRYQKYGYIGTHEYPHFSHRPSTLQAASTPQAEEDWTCTIL
• Conjugate: HRP
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(OAS1 rabbit polyclonal antibody. Western Blot analysis of OAS1 expression in MCF-7.)

Western Blot (WB)

(Western Blot analysis of OAS1 expression in transfected 293T cell line by OAS1 polyclonal antibody. Lane 1: OAS1 transfected lysate (46kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-OAS1 antibody

This protein is an enzyme included in the 2', 5' oligoadenylate synthase family. This enzyme is induced by interferons and catalyzes the 2', 5' oligomers of adenosine in order to bind and activate RNase L. This enzyme family plays a significant role in the inhibition of cellular protein synthesis and viral infection resistance.

Product Categories/Family for anti-OAS1 antibody

Antibodies; Enzymes; Synthase

NCBI and Uniprot Product Information

• NCBI GI #: 74229013
• NCBI GeneID: 4938
• NCBI Accession #: NP_058132.2
• NCBI GenBank Nucleotide #: NM_016816.2
• UniProt Accession #: P00973; P04820; P29080; P29081; P78485; P78486; Q16700; Q16701; Q1PG42; Q3ZM01; Q53GC5; A8K4N8
• Molecular Weight: 43,944 Da
• NCBI Official Full Name: 2'-5'-oligoadenylate synthase 1 isoform 1
• NCBI Official Synonym Full Names: 2'-5'-oligoadenylate synthetase 1, 40/46kDa
• NCBI Official Symbol: OAS1
• NCBI Official Synonym Symbols: OIAS; IFI-4; OIASI
• NCBI Protein Information: 2'-5'-oligoadenylate synthase 1; E18/E16; p46/p42 OAS; 2-5A synthase 1; 2-5A synthetase 1; (2-5')oligo(A) synthase 1; 2',5'-oligo A synthetase 1; (2-5')oligo(A) synthetase 1; 2'-5'-oligoisoadenylate synthetase 1; 2',5'-oligoadenylate synthetase 1, 40/46kD
• UniProt Protein Name: 2'-5'-oligoadenylate synthase 1
• Protein Family: 2'-5'-oligoadenylate synthase
• UniProt Gene Name: OAS1
• UniProt Synonym Gene Names: OIAS; (2-5')oligo(A) synthase 1; 2-5A synthase 1
• UniProt Entry Name: OAS1_HUMAN

NCBI Description

This gene encodes a member of the 2-5A synthetase family, essential proteins involved in the innate immune response to viral infection. The encoded protein is induced by interferons and uses adenosine triphosphate in 2'-specific nucleotidyl transfer reactions to synthesize 2',5'-oligoadenylates (2-5As). These molecules activate latent RNase L, which results in viral RNA degradation and the inhibition of viral replication. The three known members of this gene family are located in a cluster on chromosome 12. Mutations in this gene have been associated with host susceptibility to viral infection. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jul 2008]

Uniprot Description

OAS1: Interferon-induced, dsRNA-activated antiviral enzyme which plays a critical role in cellular innate antiviral response. In addition, it may also play a role in other cellular processes such as apoptosis, cell growth, differentiation and gene regulation. Synthesizes higher oligomers of 2'-5'-oligoadenylates (2-5A) from ATP which then bind to the inactive monomeric form of ribonuclease L (RNase L) leading to its dimerization and subsequent activation. Activation of RNase L leads to degradation of cellular as well as viral RNA, resulting in the inhibition of protein synthesis, thus terminating viral replication. Can mediate the antiviral effect via the classical RNase L-dependent pathway or an alternative antiviral pathway independent of RNase L. The secreted form displays antiviral effect against vesicular stomatitis virus (VSV), herpes simplex virus type 2 (HSV-2), and encephalomyocarditis virus (EMCV) and stimulates the alternative antiviral pathway independent of RNase L. Belongs to the 2-5A synthase family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Transferase; EC 2.7.7.84

Chromosomal Location of Human Ortholog: 12q24.2

Cellular Component: mitochondrion; endoplasmic reticulum; cytoplasm; extracellular region; cytosol; nucleus

Molecular Function: protein binding; zinc ion binding; metal ion binding; double-stranded RNA binding; ATP binding; 2'-5'-oligoadenylate synthetase activity

Biological Process: negative regulation of viral genome replication; response to virus; cytokine and chemokine mediated signaling pathway; glucose metabolic process; purine nucleotide biosynthetic process; glucose homeostasis; defense response to virus; protein oligomerization

Disease: Diabetes Mellitus, Insulin-dependent